KEGG   Pseudopropionibacterium propionicum: HMPREF9154_1217Help
Entry
HMPREF9154_1217   CDS       T02180                                 

Gene name
pfkB
Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00010  Glycolysis / Gluconeogenesis
ppc00030  Pentose phosphate pathway
ppc00051  Fructose and mannose metabolism
ppc00052  Galactose metabolism
ppc00680  Methane metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01120  Microbial metabolism in diverse environments
ppc01130  Biosynthesis of antibiotics
ppc01200  Carbon metabolism
ppc01230  Biosynthesis of amino acids
Module
ppc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9154_1217 (pfkB)
   00030 Pentose phosphate pathway
    HMPREF9154_1217 (pfkB)
   00051 Fructose and mannose metabolism
    HMPREF9154_1217 (pfkB)
   00052 Galactose metabolism
    HMPREF9154_1217 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    HMPREF9154_1217 (pfkB)
Enzymes [BR:ppc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF9154_1217 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AFN47060
UniProt: I6Y4K1
Position
complement(1345617..1346546)
Genome map
AA seq 309 aa AA seqDB search
MIVTLTPNPSIDRTVLVENLLPGEVNRAVSSRIDPGGKGVNVAHALIRNGHPARAVLPLG
GPDGELLARLLQNAGVPFDAVPIAGTTRTNIAIVDPAGVTTKVNEPGPELSPDEVERLGK
AVDGATGPVVLCGSLPPGTDDSFLAGMIARHPGRVAVDTSGAPLAAAVAAKPWLIKPNRE
ELSELTGRELPTLRAVVDSARELIAGGIGVVVVSLGSDGALWVDSDDIHHARATVTGPRS
TVGAGDCLLAGVLSALTAGGDPATALNRGVAWGAAAVALPGSAVPGPEDIAAVAVTSTPE
PDLNTVLTG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttaccctgacaccgaacccgagcatcgaccgcaccgtgcttgtggagaacctg
ctgccgggcgaggtgaaccgagccgtcagcagccgcattgacccggggggcaagggagtg
aacgtggcccacgccttgatccgcaacggccatcccgcccgtgccgtgctgccgttgggc
ggcccggacggtgaactgctggcccgcctgctacagaacgccggggttcccttcgacgcc
gtccccatcgcggggaccacacggacgaacatagccatcgtcgatcccgcgggggtcacc
accaaggtgaacgaacccgggcccgagttgtcccccgacgaggtggaacggctcgggaaa
gccgtggacggggcaaccggccccgtggttctgtgcggcagcctgccgccgggcacggat
gactcgttcctcgcggggatgatcgcccggcaccccggcagggtcgccgtcgacacgtcg
ggagccccgctggctgccgccgtggcggccaaaccctggctgatcaaacccaaccgggag
gaactctccgaactgaccggccgagaacttcccaccctgcgggccgtggtcgattccgcc
cgcgaactgatagcgggcggaatcggagtggtcgtggtgagcctgggatccgacggtgcc
ctatgggtagactccgacgacatccaccacgccagggccaccgtcaccggaccacgttcc
acggtgggtgccggtgactgcctgctggccggggttctcagtgccctcaccgcggggggc
gacccggcaaccgctctgaaccggggagtcgcgtggggggcggccgcggttgccctgccc
ggcagcgccgtgccgggccccgaggacatcgcggccgtggcggtcacgagcactcccgaa
ccagacctgaacaccgtgctcaccggctga

DBGET integrated database retrieval system