KEGG   Propionibacterium propionicum: HMPREF9154_1443Help
Entry
HMPREF9154_1443   CDS       T02180                                 

Definition
putative alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppc  Propionibacterium propionicum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF9154_1443
  Lipid metabolism
   00561 Glycerolipid metabolism
    HMPREF9154_1443
   00600 Sphingolipid metabolism
    HMPREF9154_1443
Enzymes [BR:ppc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HMPREF9154_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1563963..1566107
Genome map
AA seq 714 aa AA seqDB search
MRSRIVLRSAGVALLLTAGPDGMPEVVHWGGDPGEVSETGFEDLRLGAAWMIPGNSVDLG
PRLGIIPEARYGWTGTPGLIGSREGRAWSPGWRVSEVRVDGRPAGGFVSAGPATVDYALE
AVSAGLRMQLTVELLPTGLVRSRATLTNAGKDVFELTELTLRMPVPGQARELMDFGGRWA
AERMPQRRPFAMGAHRREGRHGRTGADAAFVLSLGEEGFGYQDGEIWACHVAWSGNHVHI
AERDFVGTQLIGGGELLLPGEGRLAVGEGYTSPWVYFNHAIGLDAQADRFHRHLRSLPVH
PGPERPVSLNVWEAVYFDHDPARLIDLAERAAALGVERYVLDDGWFGARRDDHAGLGDWV
VSPEVWPDGLHPLVNRVTELGMQFGLWFEPEMVNPDSDVARAHPEWLMQLDDRLPLEGRF
QQVLNLSIPGAYGHVLGQMSAILEEYAISYVKWDHNRDLNDAGTAPDGRPAVAAQTRAFY
ALLDELRRHFPQVEFESCSSGGSRIDLEVMERAERVWVSDNIDPDDRQRMLWWTSQLLPA
ELLGSHIASGRSHVTGRWHDLNHRAATAVFGHLGIEWDLARASEEEIAELAWWIAWYKEH
RGRLLTGRLVRVAMPDPGVWFKGVVNEFGGIYSLSMLEATPAVNLGVLRFPGLEPGPRYR
VRVIERPALAPAHQVPWLNAGHPLELTGAQLMHVGLRAPVLRPATTVLFVVTKV
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcgcgaatcgtccttcgttccgccggggtcgcgctgctgctgacggccggcccg
gacggcatgcccgaggtggtgcactggggcggtgatccgggggaggtctcggagaccgga
ttcgaggatctgcggctgggcgccgcctggatgatccccgggaactccgtcgacctcggc
ccacggctggggatcatccccgaggcccggtacggctggaccgggacgccgggcctgatc
ggctcccgggagggcagggcctggagccccggctggcgggtgagcgaggtgcgcgttgat
ggaagacccgccgggggtttcgtctccgcgggacccgcgacggtcgattacgcgctggag
gcggtttccgccgggctgcggatgcagctgaccgtcgagctgctgccgaccgggttggtg
aggtcccgcgccactttgaccaacgcggggaaggacgtcttcgaactgacggagctgacc
ctgcggatgccggtgcccggccaggcccgcgagctcatggatttcggggggcgctgggct
gccgagcggatgccgcagcgccgcccgttcgcgatgggggcgcaccgcagggagggccgc
cacggcaggaccggtgctgatgcggccttcgtgctcagcctgggtgaggaggggttcgga
taccaggatggtgagatctgggcctgccacgtggcctggagcgggaaccacgtccacatc
gccgaacgggatttcgtggggacccagctcatcgggggcggcgaactgctcctgcccggg
gaggggcgcctggcggtgggggagggatacacctcgccctgggtctatttcaaccacgcc
atcggcctggacgcccaggccgaccgtttccaccggcacctgcgctccttgcccgtgcac
ccaggccccgagcgcccggtgagcctgaacgtctgggaggcggtctacttcgaccacgac
cccgcacgcctgatcgacctggcggagcgcgccgccgccctcggggtggagcgttacgtg
ctcgacgacggctggttcggtgcccgccgtgacgatcacgccgggctcggcgactgggtg
gtcagccccgaggtgtggccggacggtttgcatccgctggtgaaccgggtgacggagctc
ggcatgcagttcggcctctggttcgaacccgagatggtcaaccctgactccgatgtggcc
cgggcgcacccggaatggctgatgcagctcgacgaccggctgcccctggagggccggttc
cagcaggtgctcaacctgtcgattcccggcgcctacgggcacgttctggggcagatgtcg
gccatcctggaggagtacgccatctcctacgtcaagtgggatcacaaccgcgacctcaat
gacgcgggcaccgctcccgacgggcgcccggccgtcgcggcgcagacgcgcgccttctac
gcgctgctcgacgaactgcgccgtcacttcccgcaggtcgagttcgagtcctgctcatcg
ggtggttcccggatcgacctggaggtgatggaacgcgcggaacgcgtgtgggtctccgac
aacatcgatcccgatgatcggcagcggatgctctggtggacctcccagctgctgcccgcg
gagctgctgggatcgcacatcgcctcggggcgctcccacgtcacggggcgttggcacgat
ctcaaccatcgcgccgccacggcggttttcgggcacctcgggattgagtgggacctggcc
cgggcctcggaggaggaaatcgcggagctggcctggtggatcgcctggtacaaggagcac
cgtgggcggctgctgaccgggcggctggtgcgggtcgccatgccggaccccggggtttgg
ttcaagggcgtggtcaacgagtttggggggatctactccctctcgatgctcgaggcgacg
cccgcggtgaacctcggtgtgctgagattcccgggcctggaacccgggccgcgctaccgg
gtccgggtcattgaacgtcccgcgctggcgccggcccaccaggtgccctggctcaacgcc
gggcatccccttgaactgacgggggcgcagctgatgcatgtcggtctgcgggctccggtg
ctccgaccggccacaaccgtcctgttcgtcgtcacgaaggtctga

DBGET integrated database retrieval system