KEGG   Propionibacterium propionicum: HMPREF9154_1493Help
Entry
HMPREF9154_1493   CDS       T02180                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppc  Propionibacterium propionicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ppc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ppc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ppc00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppc00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1625706..1627919
Genome map
AA seq 737 aa AA seqDB search
MTVRTRIGVLTSGGDAQGMNAAVRAIVRGAIQAGAEVFAIQEGWQGAVTGGDHIKQMGWN
DVSGILNKGGTVIGTARCLEFRDREGRRTAVRNLVTSGIDRLIVIGGDGSLTGTRQLRLE
WGELLAELVNSGEVGPELAERHPVLQIAGLAGSIDNDMVGTDMTIGTDSALHRITEAIDA
ISATAESHQRTFIIEVMGRNCGYLALMSAIAGGADYTFLPESPPRDGWEDRMVDVLGRGR
RAGRRDSILVVAEGAADRQGEPITANRIRDILKEKSGEDARITILGHVQRGGKPSAYDRW
MATACGVEAVSEVLEASAETEPVLVGVHSDRIGTRPLLASVVATRRIADYIAEGDYEAAI
SSRGPGFQMMIDIYRAITEARPSVADPAGKRIAIMHAGALAPGMNQLARVAVRSGIDLGY
QMLAVRGGMPGLIEGNFDDVSWADVEGMAHTGGADFGTRRYVPSESELYSMARQLEDHRV
DALLVMGGYHAYASVDLMERERRRYPAFNIPVAVVPASIDNNLPGWMMAVGADTALNTVV
DAIDMLRMSASASKRAFIVETMGRGCGFLPLVGGLAGGAEKAYLPETGITLAELETDIKA
LVDAFDSGRNFYLAVVGEGTSEHYTTDVLGKLYEAEGNGRFSVRESVVGHLQQGGTPSPF
DRINATRLAWNAIGYLDRQLRACRSEYAAAHAGAEGLFAPLRDVTDDMDWENMRPHTQWW
RSLRKPFDILSRRPGQK
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaggacgagaatcggcgtgctcacctcgggtggggacgcccagggaatgaat
gcagctgtgcgcgcgatcgtgcggggagcgatccaggcgggcgcggaggttttcgccatt
caggagggctggcagggagccgtcacgggtggcgatcacatcaaacagatggggtggaac
gacgtctccgggatcctgaacaagggcggcaccgtcatcgggacggcgcgctgtcttgag
ttccgggaccgcgaggggcgcaggaccgcggttaggaatctcgtgacctccggcatcgac
cggttgatcgtgataggtggcgacggttccctcaccggcacccgccagctgcgcctggaa
tggggtgagttgctggcggagctggtgaacagcggagaagtggggccggaactggccgaa
cgccaccccgtcctccagatcgcggggctcgccggttcgatcgacaacgacatggttggc
accgacatgaccatcgggaccgactccgcgctgcaccgcataacggaggcgatagatgcc
atctccgccaccgcggagtcacaccagagaaccttcatcatcgaggtgatgggacgcaac
tgcggttacctggcgttgatgagcgccatagcgggtggcgcggactacaccttcctgccg
gaatccccgccccgggacggttgggaggaccgcatggtggatgtcctcggccggggcagg
cgggccgggagacgcgactcgattctggtggttgccgagggcgccgcggaccggcagggc
gaaccgatcacggcgaaccgcatccgcgacatcctgaaggagaagagtggggaggacgcc
cggatcacgatcctgggacacgtccagcgcggcgggaaaccctcggcctacgaccgttgg
atggcgaccgcctgcggcgtcgaggcggtttccgaggtactcgaagccagtgccgagacc
gaaccggttctcgtcggcgtgcacagcgaccggatcgggacacgacctctgctggcctcc
gtggtggcgacccgcaggatcgccgattacatagcagagggtgactacgaggccgccatc
tcgtcgcgtggccccgggttccagatgatgatcgacatctaccgggccatcaccgaggcg
cggccgtcggtggcggatcccgcgggcaaaaggatcgcgatcatgcacgccggggcgttg
gccccgggcatgaaccagctggcgagggtcgcggtgcgttccggcatcgacctcggctac
cagatgctggcggtgcgcggtgggatgccgggcctgatcgagggcaacttcgacgatgtc
agctgggctgatgtggagggcatggcgcacaccgggggagcagatttcgggacccgccgc
tacgtcccctcggagtccgagctctactcgatggcgcgtcagctggaggaccaccgggtg
gacgccctcctggtgatggggggataccatgcctacgcgtcggtcgacctgatggaacgg
gaacgtcgacgctatcccgctttcaacatcccggtggcggtggtgccggcgagtattgac
aacaacctcccgggctggatgatggcggtcggggcggacacggccctcaacacggtcgtg
gatgcgatcgacatgctgcggatgagcgcctcggccagcaaacgggcgttcatcgtggag
acgatgggccgcggctgcggtttcctgccgctggtcggtggcttggccgggggagccgag
aaggcatacctaccggagaccggaataaccctcgccgagctcgagaccgacatcaaggcc
ctcgtcgacgccttcgactccgggcggaacttctacctggccgtggtgggggagggaacc
agcgagcactacaccacagatgtgctgggcaagctctacgaggcggaggggaacgggcgg
ttctccgtgcgggagtccgtggttgggcacctgcaacagggcggcaccccctcgccgttc
gaccgcatcaacgccacccggctggcctggaacgccattgggtacctggatcgtcagttg
cgtgcctgccggtccgagtacgctgctgcgcacgccggggccgagggtctgttcgccccg
cttcgtgacgtgaccgatgacatggactgggagaacatgcgcccccacacccagtggtgg
cgttccctgcgtaaaccctttgacatcctgagccgccgccctggccagaaatga

DBGET integrated database retrieval system