KEGG   Propionibacterium propionicum: HMPREF9154_1581Help
Entry
HMPREF9154_1581   CDS       T02180                                 

Definition
putative UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ppc  Propionibacterium propionicum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppc00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ppc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1710897..1712432
Genome map
AA seq 511 aa AA seqDB search
MTATSQSLGIMIREARKARQWSQQRLADEINSSQSAVHRIEMGQQNVSLNMIERLASALE
MPLILAATEGTVNFEITGPTELAGEIEVRSSKNAAVALLCASMLNRGRTVLRGIASIEEV
DRICDVLQSIGVTVTPTNGGQDLELTRPEKLTPETIDQRAARRTRSILMFLGPLMHEFDS
FELPYAGGCDLGARTVHPHMSALKRLGLSVEAHDSQYHATVQRDGAPEHHITLVERGDTV
TENAIMAAARTPGLTVIRNASGNYMVQDLCFFLRELGVGVDGIGTTTLRIQGVKEINKDV
EYHISEDPIEAMSLITAGIVTRSELTVKRCPIEFLEVEFAVLEEMGQRMALSSEYPSGNG
HTRLVDVTVKPSELTAPLDKIHPMPFPGLNIDNLPFFALICATAEGQSIIYDWVYDNRAV
HLKKLCDLGANVTVMDAHKLMVIGPTKWRGRDIECPPALRPSVCLFLAALAARGTTILRD
VYVINRGYEDLPRRFNQLGAQINTFWGDASS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccagccagtccctgggaatcatgatccgggaggcgcgcaaggcccgtcaa
tggtcccagcagcgcctcgccgatgaaatcaactcctcacagtccgccgttcaccggata
gagatgggccagcagaacgtctctctcaacatgatcgagagactggcatccgcgctcgag
atgcccttgatactcgcggccaccgagggcaccgtcaacttcgagatcaccgggccgacg
gagcttgcgggcgagatcgaggtccgttcctccaagaacgcggccgtcgcgctgctctgc
gcctcgatgctcaaccggggtcgcaccgtgctgcgcgggatcgccagcatcgaggaggtg
gatcgaatctgcgacgtcctccagtccatcggggttactgtcaccccgaccaatggaggt
caggatctcgaactgacccgcccggagaaactcacccccgagaccatcgaccagcgtgcc
gctcgccgcacgcgttccatcctgatgttcctcggccccctgatgcacgagttcgattcc
ttcgaactcccctatgccggcggatgcgacctcggggcccggaccgtgcatccgcacatg
tccgcgctgaaacgtctcggcctgtccgtggaggcgcacgacagccagtaccacgccacc
gtgcagcgcgacggtgcgcccgaacaccacatcaccctggtggagcgtggggacacggtc
accgagaacgcgatcatggccgccgcccgcaccccggggctgaccgtgatccgcaacgcc
tccggcaactacatggtgcaggacctgtgtttcttcctgcgcgaactgggggtcggcgtg
gacggcatcggaaccaccaccctgcgcatccagggcgtcaaggagatcaacaaggacgtc
gaataccacatctcggaggacccgatcgaggcgatgagcctcatcaccgccggcatcgtc
acccgctcggaactgacggtcaagcgctgccccatcgagttcctggaggtggagttcgcc
gttctggaagaaatgggccagcgaatggcactgagcagcgaatacccatcgggtaacggt
cacacccggctggtggacgtcaccgtgaaaccgtccgagctgacggcccccctggacaaa
atccatccaatgccgttcccggggttgaacatcgacaaccttcccttcttcgccctgatc
tgcgcgacggccgagggacagtcgatcatctacgactgggtctacgacaaccgcgcggtt
cacttgaagaagctctgcgacctgggggcgaacgtcaccgtcatggacgcccacaaactg
atggtcatcggcccgacgaaatggcgtgggcgtgacatcgagtgcccgccggcgctgcgg
ccctcggtgtgtctgttcctggcggccctcgcagcccgcggcaccaccatcctgcgggat
gtctacgtgatcaaccggggctacgaggacctgccgaggcgtttcaatcagctcggcgcc
cagatcaacaccttctggggtgacgcttcgagctga

DBGET integrated database retrieval system