KEGG   Pseudopropionibacterium propionicum: HMPREF9154_1581Help
Entry
HMPREF9154_1581   CDS       T02180                                 

Definition
(GenBank) putative UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00520  Amino sugar and nucleotide sugar metabolism
ppc00550  Peptidoglycan biosynthesis
ppc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9154_1581
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF9154_1581
Enzymes [BR:ppc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HMPREF9154_1581
Peptidoglycan biosynthesis and degradation proteins [BR:ppc01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   HMPREF9154_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase HTH_3 HTH_31 HTH_19 HTH_37 HTH_26 HTH_25 YdaS_antitoxin LigT_PEase
Motif
Other DBs
NCBI-ProteinID: AFN47755
UniProt: I6Y6F7
Position
1710897..1712432
Genome map
AA seq 511 aa AA seqDB search
MTATSQSLGIMIREARKARQWSQQRLADEINSSQSAVHRIEMGQQNVSLNMIERLASALE
MPLILAATEGTVNFEITGPTELAGEIEVRSSKNAAVALLCASMLNRGRTVLRGIASIEEV
DRICDVLQSIGVTVTPTNGGQDLELTRPEKLTPETIDQRAARRTRSILMFLGPLMHEFDS
FELPYAGGCDLGARTVHPHMSALKRLGLSVEAHDSQYHATVQRDGAPEHHITLVERGDTV
TENAIMAAARTPGLTVIRNASGNYMVQDLCFFLRELGVGVDGIGTTTLRIQGVKEINKDV
EYHISEDPIEAMSLITAGIVTRSELTVKRCPIEFLEVEFAVLEEMGQRMALSSEYPSGNG
HTRLVDVTVKPSELTAPLDKIHPMPFPGLNIDNLPFFALICATAEGQSIIYDWVYDNRAV
HLKKLCDLGANVTVMDAHKLMVIGPTKWRGRDIECPPALRPSVCLFLAALAARGTTILRD
VYVINRGYEDLPRRFNQLGAQINTFWGDASS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccagccagtccctgggaatcatgatccgggaggcgcgcaaggcccgtcaa
tggtcccagcagcgcctcgccgatgaaatcaactcctcacagtccgccgttcaccggata
gagatgggccagcagaacgtctctctcaacatgatcgagagactggcatccgcgctcgag
atgcccttgatactcgcggccaccgagggcaccgtcaacttcgagatcaccgggccgacg
gagcttgcgggcgagatcgaggtccgttcctccaagaacgcggccgtcgcgctgctctgc
gcctcgatgctcaaccggggtcgcaccgtgctgcgcgggatcgccagcatcgaggaggtg
gatcgaatctgcgacgtcctccagtccatcggggttactgtcaccccgaccaatggaggt
caggatctcgaactgacccgcccggagaaactcacccccgagaccatcgaccagcgtgcc
gctcgccgcacgcgttccatcctgatgttcctcggccccctgatgcacgagttcgattcc
ttcgaactcccctatgccggcggatgcgacctcggggcccggaccgtgcatccgcacatg
tccgcgctgaaacgtctcggcctgtccgtggaggcgcacgacagccagtaccacgccacc
gtgcagcgcgacggtgcgcccgaacaccacatcaccctggtggagcgtggggacacggtc
accgagaacgcgatcatggccgccgcccgcaccccggggctgaccgtgatccgcaacgcc
tccggcaactacatggtgcaggacctgtgtttcttcctgcgcgaactgggggtcggcgtg
gacggcatcggaaccaccaccctgcgcatccagggcgtcaaggagatcaacaaggacgtc
gaataccacatctcggaggacccgatcgaggcgatgagcctcatcaccgccggcatcgtc
acccgctcggaactgacggtcaagcgctgccccatcgagttcctggaggtggagttcgcc
gttctggaagaaatgggccagcgaatggcactgagcagcgaatacccatcgggtaacggt
cacacccggctggtggacgtcaccgtgaaaccgtccgagctgacggcccccctggacaaa
atccatccaatgccgttcccggggttgaacatcgacaaccttcccttcttcgccctgatc
tgcgcgacggccgagggacagtcgatcatctacgactgggtctacgacaaccgcgcggtt
cacttgaagaagctctgcgacctgggggcgaacgtcaccgtcatggacgcccacaaactg
atggtcatcggcccgacgaaatggcgtgggcgtgacatcgagtgcccgccggcgctgcgg
ccctcggtgtgtctgttcctggcggccctcgcagcccgcggcaccaccatcctgcgggat
gtctacgtgatcaaccggggctacgaggacctgccgaggcgtttcaatcagctcggcgcc
cagatcaacaccttctggggtgacgcttcgagctga

DBGET integrated database retrieval system