KEGG   Propionibacterium propionicum: HMPREF9154_1652Help
Entry
HMPREF9154_1652   CDS       T02180                                 

Definition
Holliday junction DNA helicase RuvA, N-terminal domain protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ppc  Propionibacterium propionicum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF9154_1652
Enzymes [BR:ppc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HMPREF9154_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1788664..1789275)
Genome map
AA seq 203 aa AA seqDB search
MISQLTGTVTAAGAAWFVIDVGGVGFRGHCTPATAAALRPGETRTIHTSLVVREESLTLF
GFGSDAEREAFELVQSASGVGPKVALAICSVLSPSDLRRAILAEDLRALCRVPGIGNKSA
QKLVLELKDKAGLLALGDAEPVEAVSAGAANELWREQVMEGLQGLGWSAKEAGVACDAVA
DLAAGGAGVAQLMRAALGTLAKR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccagctgacgggcactgtgacggccgcaggggccgcatggttcgtgatcgat
gtcgggggggtgggtttccgcggacactgcacccccgcaaccgccgctgcgctgcgtccg
ggggagacgagaaccatccacacctctctcgtcgtgcgtgaggaatcgttgacgctgttc
gggttcggcagcgatgccgagcgcgaggccttcgagttggtgcaaagcgcttcaggagtc
ggcccgaaagtcgccctggccatttgttccgtgctgtccccgagtgatctgagacgagcc
atcctcgcggaggacctgcgtgctctgtgccgggtgcccgggatcggcaacaagagcgcc
cagaaactggtgctggaactcaaggacaaggcggggctgctggccctgggcgatgcggaa
ccggtggaggccgtgagcgcaggggcggcgaacgagttgtggcgggagcaggtcatggag
ggtctccaagggctcggctggtccgccaaggaggccggggtcgcgtgcgacgcagtcgcg
gatctggccgccgggggcgccggcgtcgcccaattgatgcgggcagccctcggaacgctg
gcgaaacgctga

DBGET integrated database retrieval system