KEGG   Pseudopropionibacterium propionicum: HMPREF9154_1681Help
Entry
HMPREF9154_1681   CDS       T02180                                 

Gene name
trpB_2
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00260  Glycine, serine and threonine metabolism
ppc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01130  Biosynthesis of antibiotics
ppc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9154_1681 (trpB_2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF9154_1681 (trpB_2)
Enzymes [BR:ppc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF9154_1681 (trpB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFN45581
UniProt: I6WR15
Position
complement(1819959..1821233)
Genome map
AA seq 424 aa AA seqDB search
MSASAGTSRLLRMTALPDARGHFGRFGGTFVPEALHAALAELDTEFRAAQADPVFRAELA
GLQRNYAGRPTPVTVAENFSKHCGNATIFLKREDLNHTGAHKINNVLGQALLTKRMGKTR
VIAETGAGQHGVATATAAALLGLECRIYMGQLDTERQALNVARMQLLGAEVHAVASGSRT
LKDAMNEAMRDWVSSVENTHYLLGTVGGPHPFPYLVRELQRVISTEARAQMLEEHGGLPD
WVVAAVGGGSNAIGAFADFIPDESVHLLGIEAAGEGIETGRHAAKIGAGRPGVLHGARTF
VLQTEDGQTMESHSISAGLDYPGVGPEHAWLAETGRAGYEPVTDVEAMDAFQLLTRTEGI
IPAIESAHAVAGARRLALKLAGEQPGARPRILVCLSGRGDKDVSTAFGWFGMSGEPDRVV
GEME
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgtctgcgggaaccagtagactgctgcgcatgaccgcacttcccgatgcccga
ggccatttcggccggttcggcggaacgttcgtgccggaggcgctgcacgccgccctggcg
gagctggacaccgagttccgggccgcccaggccgatccggtcttccgggccgaactcgcc
ggcctgcaacgcaactatgcgggacgaccgacccccgtgacggtggccgagaacttctcc
aagcactgcgggaacgccacgatcttcctcaaacgcgaggacctgaaccacaccggcgca
cacaagatcaacaatgtgctcggccaggcgttgctcaccaagcggatgggaaaaacgcgc
gtgatcgcggagaccggggcagggcagcacggcgtcgccaccgcgacggcggccgctctg
ctcgggctggaatgccgcatctacatggggcagctggacaccgaacgtcaggccctcaac
gtggcccggatgcaactgctgggcgccgaggtccacgccgtcgcatccggttcccgcacc
ctgaaggacgcgatgaacgaggcgatgcgggactgggtgtcgagcgtcgagaacacccac
tacctgctcgggacggtcggcgggccgcaccccttcccctacctggtccgggagctccag
cgggtgatctccaccgaggcccgcgcccagatgctcgaggaacacggcggcctccccgac
tgggtggtggcggccgtcggcggtggttccaacgccatcggcgcgttcgccgacttcatc
cccgacgaatccgtgcacctgctcggcatcgaggccgcgggtgagggcatcgagaccggg
cgtcacgcggcgaagatcggtgcaggccgccccggggtgctgcacggcgcccgcaccttc
gtgctccagaccgaggacgggcagaccatggaatcgcactcgatctccgccggactcgac
tacccgggggtcggccccgaacacgcctggctggccgagaccggtagggccggctacgaa
cccgtcaccgacgtcgaggcgatggacgccttccagctgctgacccggaccgagggaatc
attcccgcgatcgagtccgcacacgcggtcgcgggtgccaggagactggccctgaaactg
gccggggagcaacccggagcacgcccccgcatcctggtgtgcctgtccgggcggggcgac
aaggacgtctccactgccttcggctggttcggaatgtccggtgaacccgatcgagtcgtg
ggagagatggaatga

DBGET integrated database retrieval system