KEGG   Propionibacterium propionicum: HMPREF9154_1822Help
Entry
HMPREF9154_1822   CDS       T02180                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ppc  Propionibacterium propionicum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1976782..1977849)
Genome map
AA seq 355 aa AA seqDB search
MRTEITGAKRLVVKIGSSSLTDREGHLDPARIETLAAELASLQARDKRLVLVTSGAIAAA
LGPLGLPARPKDLETQQAAAAVGQGILIRRYAEAFAAHHQMVAQVLLTAGDLQDGRSYRN
ALNTISRLFRLGVIPVINENDTVATGEIRFGDNDRLAALTAHLVRADALVILSDVDGLYT
AHPAEPGARLIPRVRDFTELVADTSRVGSRVGTGGMRTKVEAARIATSGGVSVVLAHADQ
LLAALEGEEVGTLFEAAGRRRPRRLLWLAHAAEVSGELRIDAGAARAVGKGHASLLAVGI
DDVTGDFEAGDPVDITGPGGTLLARGLVDCSATELRRRMGLGGLAVHRDLMIGIH
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaggactgagatcaccggggcgaaacgcttggtggtgaagatcgggtcgtcgtcgctg
accgatcgggaggggcacctggatccggcgcgcatcgagacgctcgccgcagaactggcc
tccctacaggcgcgcgacaaacggttggtgctggtgacctccggggccatcgcggcggcg
ctgggaccgttggggctcccggcgcgacccaaggatctcgagacccagcaggcggcggcc
gcggtcggccagggcatcctgatccggcgttacgcggaggctttcgcggcccaccaccag
atggtggcgcaggtgctgctgaccgccggtgacctgcaggacgggcgcagctaccggaac
gccctgaacacgatttcgcggttgttcagactgggggtgatccccgtgatcaacgagaac
gacaccgtcgcgaccggggagatccggttcggcgacaacgaccgcctggcggcgttgacc
gcccacctggtgcgggccgatgcgctggtgatcctgagcgacgtggatggcctctacacc
gcacacccggctgaacccggggcccggttgataccccgggtccgtgacttcacggagctg
gtggccgacacctcccgggtgggttcccgtgtcgggaccggcgggatgcgcaccaaggtg
gaggccgcccggatcgcgacctcgggtggggtttctgtggtgctggcccacgccgaccag
ctcctggcggccctggagggggaggaggtgggcaccctgttcgaggccgccggacggcga
cgaccccgcaggctgctgtggctggcccacgccgccgaggtgagcggggagctgcggatc
gacgccggtgccgcccgggccgtagggaaggggcacgcatcgctgctggcggtggggatc
gacgacgttacgggtgatttcgaggcgggcgatcccgttgacatcaccgggcccggcgga
acactgctggcacgtggattggtggactgctccgcgacggaactgcggcggcggatgggc
ctcggaggtctggccgtgcaccgcgatctgatgatcggaatccactga

DBGET integrated database retrieval system