KEGG   Propionibacterium propionicum: HMPREF9154_2013Help
Entry
HMPREF9154_2013   CDS       T02180                                 

Definition
isochorismatase family protein (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ppc  Propionibacterium propionicum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HMPREF9154_2013
Enzymes [BR:ppc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     HMPREF9154_2013
    3.5.1.-  
     HMPREF9154_2013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2203219..2203824)
Genome map
AA seq 201 aa AA seqDB search
MHAPKGPDKVTGMSRALVVVDVQRDFCEGGALAVAGGADVAGRINRLLSGEHSYDVVVAT
RDHHVDPGEHFSDSPDFKDSWPPHCVAGTPGAQQHPGLVFTKWDGLFLKGRNEAAYSGFE
GTDEATGEPLEDFLRKRGVTEVDVCGIAADYCVNATARDAALAGFETTVLIDLTVAVHPQ
SLPDLVKEWNKADLRVRRTEG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgcgccgaaagggccggataaagtgaccggcatgagccgtgcactggtggtagtc
gatgtacaacgtgatttctgcgagggaggggccctcgccgtggccgggggtgcggatgtg
gccgggagaatcaaccggctgctgtcgggggaacacagctacgacgtggtggttgccacc
cgggaccaccacgtggatccgggcgagcacttcagtgactccccggatttcaaggactcc
tggccgccgcactgcgtagcgggtacccccggtgcgcagcagcatcccgggttggtcttc
acgaagtgggacggcctgttcctgaaggggcgcaacgaggccgcctactccggtttcgaa
ggaaccgacgaggccaccggcgaacccttggaggatttcctgaggaaacgcggcgtgacc
gaggtcgatgtctgcggaatagccgccgactattgcgtcaatgccacggcccgtgatgcc
gcgctggccggtttcgaaaccaccgtcctgatcgatctcacggtcgcggtgcatccccaa
tccctgccggatctcgtgaaggaatggaacaaggcggacctgcgggtgcgcaggactgag
gggtga

DBGET integrated database retrieval system