KEGG   Pseudopropionibacterium propionicum: HMPREF9154_2092Help
Entry
HMPREF9154_2092   CDS       T02180                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00220  Arginine biosynthesis
ppc00330  Arginine and proline metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01130  Biosynthesis of antibiotics
ppc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HMPREF9154_2092 (rocF)
   00330 Arginine and proline metabolism
    HMPREF9154_2092 (rocF)
Enzymes [BR:ppc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HMPREF9154_2092 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFN47634
UniProt: I6X7R8
Position
complement(2286656..2287573)
Genome map
AA seq 305 aa AA seqDB search
MKLTLIGAPTDIGASVAGCRLGPGALRVAGIGKALRAFGVDVRDAGDVTGPPNPQSPPVD
GYRHLPEVIEWNRAVRDAVAAELADGRMPVLMGGDHSLAIGSISAIAAHCRRAGKKLRVI
WVDAHADINTNELTPSGNIHGMPVACLLGDGPEELTGMSDRKPAIEVDNIRQVGLRSVDP
GEKRVLVDKGLEVFDMRFLDEAGMRHAMERALHDIDGDTHIHLSLDLDFVDPQVAPGVGT
PVVGGPTYREAQLAMEMIADTGRLGSIDLVEINPALDIRNTTAELAVDLVESLFGKSTLL
RFTEA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgactctcatcggagcccccactgacatcggcgccagtgtcgcgggctgtcgc
ctcggaccaggggcgttacgtgtcgccggtatcggaaaagccctgcgggccttcggagtg
gatgtccgcgacgcgggcgatgtcaccgggccgccgaatccccagagcccgccggtcgac
ggctaccgccacctgccggaggtgatcgagtggaaccgggcggtgcgcgacgcagtcgcc
gccgaactggcggacggccggatgccggtgctgatgggcggcgaccacagcctggccatc
ggcagcatcagcgccatcgccgcgcactgccgcagggccggcaagaagctgcgcgtcatc
tgggtggacgcccacgccgacatcaacaccaatgaactcaccccctccgggaacatccac
ggcatgccggtggcctgcctgctcggcgacggaccggaggaactgaccggtatgtcggac
cggaaacccgccatcgaagtggacaacatccgccaggtcgggttgcgcagcgtcgatccc
ggcgagaaacgggtgctcgtggacaagggcctcgaggtgttcgacatgcgtttcctcgac
gaggccggcatgcggcacgccatggaacgtgccctccacgacatcgacggggacacccac
atccacctaagcctcgatctagatttcgtggacccgcaggtcgcccccggtgttggtacc
ccggtcgtcgggggaccgacctaccgggaggctcagctggccatggagatgatcgccgac
accgggaggctgggttccatagacctggtcgagatcaacccggcactcgacatccgcaac
accaccgccgaactcgccgtcgacctcgtcgagagcctgttcggcaagtccaccctgctt
cgtttcaccgaggcctga

DBGET integrated database retrieval system