KEGG   Propionibacterium propionicum: HMPREF9154_2104Help
Entry
HMPREF9154_2104   CDS       T02180                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppc  Propionibacterium propionicum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9154_2104 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF9154_2104 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HMPREF9154_2104 (sucB)
Enzymes [BR:ppc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HMPREF9154_2104 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2298912..2300588
Genome map
AA seq 558 aa AA seqDB search
MSTEVTLPALGESVTEGTISRWLKAVGETVEVDEPLLEVSTDKVDTEIPSPVAGTLLEIR
FNEDDVAEVGAVLAVIGEASEAPAPQAAPAPQPVAEAAPAPAPAPAPAAPPAPATPQAVP
AGNATEVVLPVLGESVTEGTVSRWLKAVGETVEVDEPLLEVSTDKVDTEIPSPVAGTLLE
IRVAEDETAAVGAVLALVGDAAVAPPAPAPAAPPAPAVTAPAAAPTAPAASVMARRASAD
EGVYVTPLVRKLAAEHGVSLSSVQGTGVGGRIRKQDILDAAEAAKKAASAPAPTAAAVAS
APATAAPQVAAVSEEAAKLRGTTEKLSRMRKVIAERMTESLRVASQLTATVEVDVTAISK
LRRAAKDEFKKREGASLSYLPFITKATIEALKAMPALNASADFEAGTVTYASQENIGIAV
DTDRGLMVPVIQDAGDLNLAGLAKRIGDLAARTRAGKVGPDELSGGTFTITNYGSAGTLF
DTPIINLPQVAILGTGALVKRPVVVTDALGGDTIAIRDMMYLSLTYDHRLIDGAKAARFL
SLIKARLEAGDFAGDLGL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccgaagtaacactcccggcactgggcgagtcggtcactgaaggcaccatctcc
cgctggcttaaggccgtcggcgagaccgtcgaggtggacgaacccttgttggaggtctcc
accgacaaggtggacaccgagatcccctcccccgtggccggtaccctcctggagatcagg
ttcaacgaggacgacgtggcggaggtcggcgccgttctggccgtgatcggcgaggccagt
gaggctcccgccccgcaggcagcacccgcgccccagcccgtcgccgaggccgcccccgct
ccagcacccgcccccgctcctgcggcacctccggcacccgccacgccgcaggccgttcct
gcgggcaacgcgaccgaagtggtgctccccgttctcggcgagtcggtcaccgagggcacc
gtctcccgctggctgaaggccgtcggcgagaccgtcgaggtggacgaacccctgttggag
gtctccaccgacaaggtggacaccgagatcccctcccccgttgcgggcaccctcctggag
atccgcgtcgcagaggacgagaccgccgcggtcggggccgttctggcgctggtcggcgat
gccgccgtcgctcccccggcacccgctcccgcagcacccccggcacccgcggtcaccgct
cccgcagctgcaccgacggcacccgctgcgtcggtcatggcgcgccgcgcctctgccgac
gaaggggtctacgtcacccccttggtccgcaagctcgccgcggagcacggcgtctccttg
agttccgttcagggcaccggtgtcggcggccgcatccgcaaacaggacatcctcgatgcc
gcggaggccgccaagaaggccgcttccgcacccgcccccaccgccgccgcggtggcgagc
gcgcccgccaccgcggccccccaggttgccgccgtctcggaggaagcagcgaaactgcgt
ggcaccacggagaaactgtcacggatgcgcaaggtgatcgccgagaggatgacggaatcg
cttcgggtggcctcgcagctcaccgccaccgtcgaggtggacgtgaccgccatctcgaaa
ctgcgcagagcggcgaaggatgagttcaagaagcgcgagggcgcatccctgtcctacctg
ccgttcatcacgaaggccaccatcgaggccctgaaggcgatgcccgcgctcaacgcgtcg
gccgacttcgaagcgggtaccgtgacctacgcgtcgcaggagaacatcggcatcgcagtc
gacaccgatcgcggtctgatggttcccgtgatccaggacgccggggacctgaacctggcc
gggctggccaagcgcatcggcgacctcgcggcccgcacccgcgcagggaaggtcggcccc
gacgagctgagtggcggcaccttcaccatcaccaactacggctcggcgggaaccctgttc
gacaccccgatcatcaacctgccgcaggtcgcgatcctcggcaccggcgcgctggtgaag
cggcccgtggtggtcaccgacgccctgggcggtgacaccatcgccatccgggacatgatg
tacctgtcgctcacctacgaccaccgcctcatcgacggcgccaaggccgcccgcttcctc
agcctgatcaaggcccgcctggaagccggtgacttcgccggcgacctggggctctga

DBGET integrated database retrieval system