KEGG   Propionibacterium propionicum: HMPREF9154_2447Help
Entry
HMPREF9154_2447   CDS       T02180                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppc  Propionibacterium propionicum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ppc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2645639..2647162)
Genome map
AA seq 507 aa AA seqDB search
MTDTKYVLAIDQGTTSSRAIIFDHAGRIVAVGQKEHEQIFPRAGWVEHNAAEIWDNVREV
VAQALAKAQLNKENLAAVGITNQRETTLVWDRKTGEPVYNAIVWQDTRTQKIVEELGGEQ
GADRYKEIVGLPLATYFSGPKVKWVLDNVEGARERAEAGDLVMGTMDTWVLWNLTGGVKG
GVHITDVTNASRTMLMNLKTLDWEPSIAADMGIPMSMLPEIRSSAEVYGVCRPQGLLAGV
PVAGILGDQQAATFGQACFEKGMAKNTYGTGCFMLMNTGEEIVPSKNGLLTTLCYKIGDA
KPIYALEGSIAVAGSLVQWLRDNLRMFDSAPEIETLAATVDDNGGAYIVPAFSGLFAPYW
RADARGALVGLTRYVNRGHIARAVLEATAFQTREVLDAMEADSGVKLTELKVDGGMTANE
TLMQFQADQLGVDVVRPVVAETTALGAAYAAGIAVGFWGGEQDVIDNWAEDKRWGPEMDE
AERDRLYRNWKKAVTKTLDWVDDDVVE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaccaaatacgtgctcgccattgaccagggaaccacctcgtcgcgcgcgatc
atcttcgaccacgcaggccgcatcgtcgccgtggggcagaaggaacacgaacagatcttc
ccccgcgccggctgggtggagcacaacgccgccgaaatctgggacaacgtccgtgaggtc
gtcgcccaggctctcgcgaaggcgcagctgaacaaggagaacctggccgcggtcggtatc
accaaccagcgcgagaccactctcgtgtgggacaggaaaaccggtgagcccgtctacaac
gccatcgtctggcaggacacccgcacccagaagatcgtcgaggagctcggcggcgagcag
ggagccgaccggtacaaggagatcgtcgggctgccgctggccacctacttctccggaccg
aaggtcaagtgggtgctcgacaacgtcgagggtgccagggaacgcgccgaggccggcgac
ctggtgatgggcaccatggacacctgggtgctgtggaacctcaccgggggtgtgaagggt
ggcgtgcacatcaccgacgtcaccaacgcctcccgcaccatgctgatgaacctcaagacc
ctcgactgggagccctccatcgctgccgacatgggcatcccgatgtcgatgctgccggag
atcaggtcgtcggccgaggtctacggcgtgtgtcgtccgcagggtcttctggccggtgtt
ccggtcgcaggcatcctcggtgaccagcaggccgcgaccttcgggcaggcctgtttcgag
aagggcatggcgaagaacacctacggcaccggctgtttcatgctcatgaacaccggcgag
gagatcgtcccctccaagaacgggctgctgacgacgctgtgctacaagatcggcgacgcg
aaacccatctacgcgctggagggttccatcgcggtggcggggtcgctggtgcagtggctg
cgtgacaacctgcggatgttcgactccgcccccgagatcgagaccctcgcggcgacggtc
gacgacaacggtggcgcctacatcgtgcccgcgttctcgggtctgttcgccccctactgg
cgggccgacgcgcgcggcgcgctggtgggtctcacccgctacgtcaaccgcggccacatc
gcccgcgccgttctggaagccacggccttccagacccgcgaggtgctggacgccatggag
gccgactcgggtgtgaaactgaccgagctgaaggtcgacggcggcatgaccgccaacgaa
accctcatgcagttccaggccgaccagctcggcgtcgacgtggtgcgtcccgtcgtcgct
gagaccacggcgctcggcgcggcctacgcggcgggcatcgccgtcgggttctggggcggt
gagcaggacgtcatcgacaactgggccgaggacaagcgctggggtccggagatggacgag
gccgaacgcgaccgcctgtaccgcaactggaagaaggccgtcaccaagaccctcgactgg
gtcgacgacgacgtcgtggagtga

DBGET integrated database retrieval system