KEGG   Propionibacterium propionicum: HMPREF9154_2497Help
Entry
HMPREF9154_2497   CDS       T02180                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ppc  Propionibacterium propionicum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2696402..2697118)
Genome map
AA seq 238 aa AA seqDB search
MYEGPIQDLIDELSRLPGIGPRGAQRIAFHLLDAPEEEVFQLADVLRRVKEAARFCEVCF
NVSQETRCRVCRDPRRDRSLLCVVEESKDVVAIERTGEFRGTYHVLGGSISPIDGRGPGD
LHTRELFQRLADGTVTEVILATDPDTEGEATASYLGRMLRDFGVRVTRPASGLPVGGDIE
YADQITLGRAFEGRRSMFGDEPEPAPQPTPEEPARDETTGDDRERNTAYQSLVGTPAR
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgagggccccatccaggacctgatcgacgagctgagccgcctgcccggcatcggc
ccgcgcggcgcgcagcgcatcgccttccacctgctcgacgcgcccgaggaggaggttttc
cagctcgccgacgtgctgcgccgcgtcaaggaggcggcgcggttctgcgaggtgtgtttc
aacgtgtcgcaggaaacccgctgccgggtgtgccgcgacccgcgtcgtgaccggtcgctg
ctgtgcgtggtggaggagtcgaaggacgtggtcgccatcgaacgcaccggcgagttccgc
ggcacctaccatgtgctgggtgggtcgatctccccgatcgacggccgcggccccggcgac
ctgcacacccgggaactgttccagcgcctcgccgacgggaccgtcaccgaggtgatcctc
gccaccgaccccgacaccgagggcgaggcgacggcctcctacctgggacggatgctgcgc
gacttcggggtgcgcgtcacccggcccgcgtccgggttgcccgtcggcggcgacatcgag
tacgccgaccagatcactctcggcagggccttcgagggacgccgttccatgttcggcgac
gaacccgaaccggcccctcagcccacccccgaggagcccgcgcgggacgagacgacgggc
gacgaccgggaacgcaacacggcctaccagtcgctggtgggaaccccggcccgctga

DBGET integrated database retrieval system