KEGG   Propionibacterium propionicum: HMPREF9154_2602Help
Entry
HMPREF9154_2602   CDS       T02180                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppc  Propionibacterium propionicum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF9154_2602
   00052 Galactose metabolism
    HMPREF9154_2602
   00500 Starch and sucrose metabolism
    HMPREF9154_2602
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9154_2602
Enzymes [BR:ppc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF9154_2602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2805709..2807034)
Genome map
AA seq 441 aa AA seqDB search
MDGSAIGVFSHYYRLLESGETGLIREESIEPLLDPPMLDDIEVSDGEAREAIGATVMIKL
NGGLGTSMGLDRAKNLLEVRDGLNFLDLIVRQVRAARRDWDAPLPLLFMNSFRTDADTLA
HLERYPDLPVDDLPLSFLQNQEPKLRADDLTPVEWPKDPSLEWCPPGHGDLYTALWGQNL
LQRLIEKGFRYACISNGDNLGAAPNARLAGWFASSGAPYAAELCRRTVNDRKGGHLAIRK
RDGQLILRDTAQTAPEEMDYFTDEHRHPFFHTNNLWFDLQRLFDTIRERDAVLGLPMIRN
EKTVDPADPDSPKVIQVETAMGAAIEVFPGATAICVGRDRFQPVKTTDELLLLRSDVYDL
DENGHLVARSATPGISLDSRYYKTIQKFDARIPQPPSLRGAESLRVEGDWSFEPGVKVVG
SVDLPDEGTPRVVPAGTVLGA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtggatggcagcgcgattggggtgttctcgcactattaccgcctactggaatcgggggag
accgggttgatccgggaggagagcatcgaacctctgctcgacccgccgatgctggatgac
atcgaggtaagcgacggcgaggcccgcgaagcgatcggcgccaccgtcatgatcaagctc
aacggcgggctcggcacgtcgatggggctggacagggccaagaacctcctcgaggtgcgt
gacggcctgaacttcctggacctcatcgtgcgacaggtgcgggcagcccggcgtgactgg
gacgccccgctgccgctgttgttcatgaactccttccgcaccgatgccgacaccctggcc
cacctggaacgttaccccgaccttcccgtcgacgacctgccgcttagttttctgcagaac
caggaaccgaaactcagggcggacgaccttaccccggtggagtggccgaaggatccgtcg
ctggagtggtgcccacccggccacggcgacctctacaccgctctgtggggacagaacctg
ttgcaacgcctcatcgagaagggtttccgctacgcctgtatctccaacggagacaacctc
ggggccgccccgaatgcccgcctggcgggctggttcgcctcgtccggtgccccctacgcc
gccgaactgtgccgccgcaccgtcaacgaccgcaagggtgggcacctggccatccgcaaa
cgcgacggacagctcatcctccgcgacaccgctcagaccgcacccgaggagatggactac
ttcaccgacgagcaccggcacccgttcttccacaccaacaacttgtggttcgacctgcaa
cgcctgttcgacaccattcgcgaacgcgacgcggtgctcggcctgccgatgatccgcaac
gagaagacggtcgacccggccgatcccgactcgcccaaggtcattcaggtggagactgcg
atgggggcggcgatcgaggtgttcccgggggccaccgccatctgtgtcggccgtgaccgg
ttccagcccgtcaagaccaccgacgaactgctgctgctgcgctccgacgtctacgacctc
gacgagaacgggcatctcgtggcgcgctccgccacgcccgggatcagcctggattccagg
tactacaagaccatccagaagttcgatgcccgcatcccgcagcccccgtcgctgcgcggg
gccgagagcctccgggtcgagggtgactggagtttcgagccgggcgtgaaggtggtgggt
tccgtcgacctgcccgacgaggggacgccacgggtcgttcccgccggcaccgtgctgggc
gcctga

DBGET integrated database retrieval system