KEGG   Pseudopropionibacterium propionicum: HMPREF9154_2802Help
Entry
HMPREF9154_2802   CDS       T02180                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00260  Glycine, serine and threonine metabolism
ppc00750  Vitamin B6 metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01120  Microbial metabolism in diverse environments
ppc01230  Biosynthesis of amino acids
Module
ppc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9154_2802 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF9154_2802 (thrC)
Enzymes [BR:ppc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF9154_2802 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFN45659
UniProt: I6X244
Position
complement(3024412..3025827)
Genome map
AA seq 471 aa AA seqDB search
MRYVSTRATDHTTRAFSDILLEGLAPDGGLYLPVEYPRVDAGTLARWRDVLLDDGYAGLA
FEVCSLFIDDIPADDLLGICRRAYAPGKFLDPQIVPVSELSDGVRLAHLSNGPSAAFKDM
AMQLLGELFAHELARRGERLTILGATSGDTGSAAEYALLGRPGIRVVMLSPADRMTPFQQ
AQMYSIDDPGVVNLAVAGVFDDCQDLVKAINADAEFKRDHRIGAVNSINWARLMAQVVYY
FAAWLRTGGDGPVSFAVPSGNFGNIAAGHIARLMGLPIRHLVLATNENDVLDEFFRTGVY
RPRAAQQTHATSSPSMDISKASNFERFVADLLGRDGARVADLFGRELPETGRLDLSGEDR
DRFGFVSGSSTHADRLAEIRATWENDRVLIDPHTADGVHVARRLLASGEVTGPVVVLETA
LPVKFAETITQATGIVPPRPDRFAGIEDLPRHVTRIPADVDAVRRAIDGAA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgcgatacgtctccacccgtgccaccgaccacaccaccagggccttcagcgacatcctc
ctggagggcctggcacccgacggcggcctctacctgcccgtcgaatacccgcgggtggac
gccggcaccctcgcccggtggcgcgacgtgctgctcgacgacggctacgcggggctcgcc
ttcgaggtgtgctccctgttcatcgacgacatccccgccgacgacctgctgggcatctgc
cggcgcgcctacgcgcccgggaagttcttggacccgcagatcgtgccggtttccgaactc
tccgacggggtgcggctggcgcacctcagcaacggcccgtcggcggccttcaaggacatg
gccatgcagctgctcggcgagctgttcgcccacgaactggcgcgccgcggcgagcgcctg
accatcctcggcgccacctccggcgacaccggctcggccgccgagtacgcgctgctgggc
aggcccgggatacgggtggtgatgctctccccggcggaccgcatgaccccgttccagcag
gcccagatgtactccatcgacgaccccggggtggtgaacctggccgtagcgggtgtcttc
gacgactgccaggacctcgtcaaggccatcaacgccgacgccgagttcaaacgcgaccac
cgcatcggcgcggtgaactccatcaactgggctcgcctgatggcgcaggtcgtctactac
ttcgcggcatggctgcgcaccggcggcgacggccccgtctcgttcgcggtgccgtcgggc
aacttcggcaacatcgcggccgggcacatcgcccgcctcatggggctgcccatccggcac
ctggtgctggccaccaacgagaacgacgtcctcgacgagttcttccgcaccggcgtctac
cggccccgcgccgcgcaacagacccacgccaccagctccccgtccatggacatctcgaag
gcgtcgaacttcgaacgtttcgtcgccgacctgctgggccgcgacggtgcgcgcgtcgcc
gacctgttcggtcgcgaactgccggaaaccggcaggctcgacctgtccggcgaggaccgc
gaccgtttcggtttcgtatcgggttcctccacccacgccgaccggctggccgagatccgc
gccacttgggagaacgaccgcgttctcatcgatccccacaccgccgacggcgtgcacgtc
gcccgccggctgctggcctccggtgaggtgaccggacccgtcgtcgtgctggaaaccgcg
cttcccgtgaagttcgccgagaccatcacccaggcaaccggcatcgtcccaccgcgcccc
gaccgtttcgccgggatcgaggacctccccaggcacgtgacgcgcatccctgcggacgtg
gacgcggttcggcgagctattgacggggccgcctga

DBGET integrated database retrieval system