KEGG   Propionibacterium propionicum: HMPREF9154_2917Help
Entry
HMPREF9154_2917   CDS       T02180                                 

Gene name
bchI_1
Definition
magnesium-chelatase 38 kDa subunit (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ppc  Propionibacterium propionicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF9154_2917 (bchI_1)
Enzymes [BR:ppc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HMPREF9154_2917 (bchI_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3161285..3162283)
Genome map
AA seq 332 aa AA seqDB search
MSRSSYPFAAIVGQDEMKLALVLTVINPAVSGVLIRGDKGTAKSTAVRGLAELLPERVEV
GATPYHLSPAEYREYWEELGLPAQDDPVERRTRVPVVELPIGATEDRVAGTLDLETALTA
GRKRFEPGLLADAHRGILYVDEVNLLDDHVVDLLLDSAAMGVNTVEREGISLTHPARFSL
VGTMNPEEGELRPQLLDRFGLCVTVVGESDPPARVEIIERRLAFEADPVGFCAGWRAEGE
RLARQIASAMDLLPEVTVGREVLLEVARICVDAGVDGHRADITMVRAARALAAWHGRTGI
ETADLQQAARLVLPHRMRRRPLEGIGTPHGRG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagccggtccagttatccctttgccgcgatcgtggggcaggacgagatgaaactcgcg
ctggtgcttacggtcatcaaccccgcggtgtcgggggtgctgatccgcggcgacaagggc
accgcgaagtccaccgcggtgcgcggcctggccgagctgctgccggagcgggtcgaggtg
ggcgccaccccctatcatctgtcgccggcggagtaccgggagtactgggaggagctgggg
ctgcccgcccaggacgatcccgtggagcgccggacccgggtgccggtggtggagctgccg
atcggggcgaccgaggaccgggtggcggggacactggacctggagaccgccctgaccgcg
ggccgcaagcggttcgagccggggctgctggccgacgcccaccggggcatcctgtacgtg
gacgaggtgaacctcctggacgaccacgtggtggatctgctgctggattccgcggcgatg
ggggtcaacaccgtggagcgggagggcatcagcctgacccacccggcccggttctcgctg
gtcggcacgatgaacccggaggagggcgaactgcgcccccagttgctggaccggttcggg
ctgtgcgtcaccgtcgtgggggagtccgacccgccggcccgggtggagatcatcgagcgc
aggctggccttcgaggccgacccggtggggttctgcgcggggtggcgcgccgagggcgag
cggctggcccggcagatcgcgtccgcgatggacctgctgccggaggtgacggtgggccgt
gaggtgctgctggaggtggcccggatctgcgtggacgcgggggtcgacggtcaccgggcc
gacatcaccatggtgcgggccgcccgggcgctcgccgcgtggcacggccggaccggcatc
gagaccgcggacctgcaacaggccgcccgcctggtgctgccgcaccggatgcgccgccgc
ccgctggagggcatcgggacgccccacggcaggggctga

DBGET integrated database retrieval system