KEGG   Propionibacterium propionicum: HMPREF9154_2918Help
Entry
HMPREF9154_2918   CDS       T02180                                 

Gene name
bchI_2
Definition
magnesium-chelatase 38 kDa subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ppc  Propionibacterium propionicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3162280..3164295)
Genome map
AA seq 671 aa AA seqDB search
MGRATTRSRPSRSGACSTRRRRTAARNAVSWRPGSRSATARPSRKPPPRNVTRLFPFSAI
VGQPRMRLALQLVAIDPGIGGVLIQGAKGTAKSTMVRSLAALLPSGRLRTLALGATEDRL
VGGLDLEATLTGGAPRFLPGLLAETHGGVLYVDEVNLLADHLTDLVLDAAASGVVLTERE
GFSRTQQARFALVGTMNPEEGALRPQLLDRFGLCVQVDGSPDLDERVEIMARRLAFDADP
EAFAGAWADQEAALAERLRRARDTAPAVWLGRDIQELVAARVLAAHVAGHRAELVMCRAA
RAHAAWRGSQRVSEEDVEAVAELVLAHRRRQAVEPPPPTSAQATRPEPPPASSPPPAETD
ADAPASGGTPPEDVAATGEPFRVRPLHPAAERGGRLGSGRRTTAVSAGGRGRYVRARPTR
EAVDLALDATLRAGAVHQRERRLRAAEKGDPRSELAVLIEPSDWFRKVRVRQTGSLVVLC
VDASGSMGARNRMVASKGAVLSLLLDAYVKRDQVSLVSFRGAEAQVLVEPTSSVELAERR
LRELPVGGRTPLAAGLVEASRVVRRALLKDPALRPLVIVVTDGRGNVDLAGRVSRGAAAE
VTEIAGRLGGDGRVTWVVVDTEPASPAARGHGATLAAALGASRFEIEQLRADDLVSVVRD
MRLATVKKEGR
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgggcagggcaacgacgcgatcaagaccctcaaggagcggggcatgttcgacaaggcgc
agaaggaccgcggccaggaacgcggtgagctggaggcctggttccagaagcgctacggca
agaccatcgaggaagccgccaccccgtaacgtgacgaggctcttccccttctcggccatt
gtggggcagccgcggatgcggctcgccctgcaactggtcgccatcgaccccgggatcggc
ggggtgctgatccagggcgccaagggcaccgccaaatccaccatggtgcgttccctcgcc
gcgctgctgccatccggaaggttgcggacgctggccctgggcgccaccgaggaccgcctg
gttgggggcctggacctggaggcgacgctgaccggaggcgccccccggttcctgccggga
ttgctggccgagacccacggcggggtcctctacgtcgacgaggtcaacctgctcgccgac
cacctgaccgacctggtgctggacgccgcggccagcggggtcgtcctcaccgagcgggag
gggttctcccgcacccagcaggcccggttcgcgctggtcggcacgatgaaccccgaggag
ggggcgctgcgtccccagctgctggatcgcttcggcctgtgcgtccaggtggacggctca
cccgacctggacgagcgggtcgagatcatggcccgcaggctcgccttcgacgccgaccca
gaggccttcgcgggggcctgggcggaccaggaggctgccttggcggagcggctccgccgg
gcccgggatacggcccccgcggtgtggctgggccgggacatccaggaactcgtcgcggcg
cgggtgctggccgcccacgtcgccgggcaccgggccgagctggtgatgtgccgcgccgcc
cgggcccacgcggcctggcggggcagccagcgggtgagcgaggaggacgtggaggcggtc
gccgagttggtgctggcccaccgtcgccgccaggccgtcgaaccgcccccacccacctcg
gcgcaggccacccggcccgaacccccacccgcctcgtccccgccgccagccgagacggac
gccgacgccccggcgtccggtggcaccccacccgaggatgtcgccgcaaccggtgagccg
ttccgggtgcgtccgttgcacccggccgcggagcggggcggacgcctcgggtcgggccgg
cgcaccacagcggtcagcgccggcggccggggccgctacgtccgtgcccgcccgacgcgg
gaggccgtggacctggccctggacgccacgctgcgggccggggccgtgcaccagcgcgag
cgccgcctccgggccgccgagaagggtgacccccgcagcgaactggcggtgctgatcgaa
cccagcgactggttccgcaaggtccgggtgaggcagaccggctccctggtggtgctgtgt
gtggacgcctccggctccatgggtgcccgcaaccggatggtggccagcaagggtgcggtg
ctcagcctgctgctggacgcctacgtcaaacgcgaccaggtgtcgctggtcagcttccgc
ggcgccgaggcccaggtgctggtggaacccacctcctcggtcgagttggccgagcggcgg
ctgcgggagctacctgtgggtgggcgtaccccgctggccgcgggcctggtcgaggcgtcg
cgggtggtgcggcgggcgctgctgaaggacccggcgctgcgtccgctggtgatcgtggtg
accgatggacgcggcaacgtcgacctggccgggcgggtgtcccgcggcgcggccgctgag
gtgaccgagatcgccgggcggctcggcggcgacggccgggtgacgtgggtggtcgtcgac
accgaaccggcctcaccggcggcgcgggggcacggtgccaccctggcggccgcgctgggg
gcgtcccggttcgagattgagcagctgcgcgccgacgacctggtgtcggtggtgcgcgac
atgcgtttggccactgtgaagaaggaggggcgatga

DBGET integrated database retrieval system