KEGG   Propionibacterium propionicum: HMPREF9154_3163Help
Entry
HMPREF9154_3163   CDS       T02180                                 

Gene name
pyn
Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.2)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ppc  Propionibacterium propionicum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HMPREF9154_3163 (pyn)
Enzymes [BR:ppc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     HMPREF9154_3163 (pyn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3424257..3425624
Genome map
AA seq 455 aa AA seqDB search
MRRIFWRTRYKILHAHGETFHRTSPRLVGMDAIEVISTKRDGGRLSDDQIDWVIRAYTDG
VVADEQMSALAMAILLNGMDRDEISRWTAAMIASGQRMDFSSLGRPTADKHSTGGVGDKI
TLPLTPLVAAFDVAVPQLSGRGLGHTGGTLDKMESIPGWRAALGNEELLAQLADVGAVVC
AAGSGLAPADKKLYALRDATGTVEAIPLIASSIMSKKIAEGTGALVLDVKVGSGAFMKTR
DRAEELARTMVALGTDAGVNTVALLTNMDTPLGRTAGNALEVRESLEVLAGGGPRDVVEL
TVRLAREMLAAAGKPDVDPAPALQDGRAMDVWRRMVAAQGGDPDAPLPVAEHTHVVAAES
DGYVARLDAMAVGVAAWRLGAGRARKEDDVQAVAGVEMHAKPGDHITRGAPLFTLHTATP
ERFERALEALDGAVTCSGSPVTPDPVILGRIEAGA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaaggattttctggcgtacccggtacaaaatccttcacgcccacggcgaaaccttt
caccgaacgagtcctagactcgtcggcatggacgccatagaggtcatctccaccaaacgc
gacggcggcaggctcagcgacgaccagatcgactgggtgatccgggcctacaccgacggg
gtggtggccgacgagcagatgtcggcgctggcgatggcgatcctgctcaacggcatggac
cgcgacgagatctcccgctggaccgccgcgatgatcgcctccggccagcgcatggacttc
tcgtcgctgggcagacccaccgccgacaagcactccacgggcggggtcggcgacaagatc
accctgcccctgacgcccctggtggcggccttcgacgtggcggtgccgcagctgtcggga
cgcggcctgggacacacgggcggcaccctcgacaagatggagtccatcccgggctggcgc
gccgccctgggcaacgaggagttgctggcgcagctggccgacgtcggagcggtggtctgc
gccgccggttccggcctggccccggccgacaagaagctctacgccctgcgcgacgccact
ggcaccgtagaggccatcccgctgatcgcgtcgtcgatcatgagcaagaagatcgcggag
ggcacgggggcgctggtgctggacgtgaaggtcggttcgggcgcgttcatgaagacccgc
gaccgcgcggaggagctggcccgcaccatggtggcgctggggacggacgcgggcgtcaac
accgtcgcgctgctgactaacatggacacccccctcggccggaccgcagggaacgcgctc
gaggtccgcgagtcgctggaggtgctggcgggcggtggcccgcgcgacgttgtggagctg
accgtgcgactcgcccgcgagatgctggccgccgccggcaaaccggatgtcgacccggcc
ccggcgctgcaggacggccgcgcgatggacgtgtggcggcgcatggtcgcggcgcagggc
ggcgaccccgatgcgcccctgccggtggcggaacacacccacgtggttgccgcggaaagc
gacgggtacgtcgcacgcttggacgcgatggcggtcggggtggctgcctggcggctgggc
gcgggccgggcccgcaaggaggacgacgtgcaggcggtcgcgggcgtcgagatgcacgcc
aaacccggcgaccacatcacccggggagccccgctgttcaccctccacaccgccacaccg
gagcgcttcgaacgtgccctggaggccctcgacggcgccgtcacctgctccgggagcccg
gtcacccccgacccggtgatcctgggaaggatcgaggccggcgcctga

DBGET integrated database retrieval system