KEGG   Pseudopropionibacterium propionicum: HMPREF9154_3171Help
Entry
HMPREF9154_3171   CDS       T02180                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00071  Fatty acid degradation
ppc00280  Valine, leucine and isoleucine degradation
ppc00310  Lysine degradation
ppc00360  Phenylalanine metabolism
ppc00362  Benzoate degradation
ppc00380  Tryptophan metabolism
ppc00410  beta-Alanine metabolism
ppc00627  Aminobenzoate degradation
ppc00640  Propanoate metabolism
ppc00650  Butanoate metabolism
ppc00903  Limonene and pinene degradation
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01120  Microbial metabolism in diverse environments
ppc01130  Biosynthesis of antibiotics
ppc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HMPREF9154_3171
   00650 Butanoate metabolism
    HMPREF9154_3171
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF9154_3171
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMPREF9154_3171
   00310 Lysine degradation
    HMPREF9154_3171
   00360 Phenylalanine metabolism
    HMPREF9154_3171
   00380 Tryptophan metabolism
    HMPREF9154_3171
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HMPREF9154_3171
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HMPREF9154_3171
   00281 Geraniol degradation
    HMPREF9154_3171
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMPREF9154_3171
   00627 Aminobenzoate degradation
    HMPREF9154_3171
   00930 Caprolactam degradation
    HMPREF9154_3171
Enzymes [BR:ppc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HMPREF9154_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AFN45651
UniProt: I6WRC0
Position
3430013..3430930
Genome map
AA seq 305 aa AA seqDB search
MTDLLVTTLDDGVATLTLNRPNAINSLNLEMLQTASELLTSWAHDDSVREVVLRGEGTRG
FSAGADVRELSQAVSDRGPWLRFLEVEYLLDLIVAQFPKHITAHLNGITMGGGLGLTVNA
DRRIVDSSTLMAMPETKIGFFPDAGVMYWLARAGALGTHMALTSGTVGGGDALRINLADE
SADGDLPTPLSEAVWIQECYTGDDPVEIARRLEEHPDPAAQQAGRELRARSPFSVHVALR
ALRRAATLDLNGVLHQDLRLAEHMIPVDFVEGVRALLIDKDNQPAWRYATLEDVPTRAVD
EVFSY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgactgatctgctcgtcaccaccctggacgacggggtcgcgactctcaccctcaaccgt
cccaacgccataaactccctcaacctggagatgctccagacagcaagcgaactcctcacc
tcgtgggcccacgacgactcggtgcgggaggtggtgctccgcggcgagggaacgcgcggg
ttcagcgcgggcgctgatgtgcgggagttgtcgcaggctgtcagcgacagggggccctgg
ctgcggttcctggaggtcgagtacctgctcgacctgatcgtcgcccagttccccaaacac
atcaccgcccacctcaacggcatcaccatgggcggcggcctgggtctgacggtcaacgcc
gaccggcgaatagtcgattcgtcgacgctgatggcaatgccggagacgaaaatcggtttc
ttcccggacgcgggtgtcatgtactggctggcgcgagcgggagcgctgggcacccacatg
gcgctgacctccggcacggtcggcgggggcgacgccttgcgcatcaacctggccgacgag
tcggccgacggtgacctgcccaccccgctgtcggaggccgtctggatccaggagtgctac
accggcgatgacccggtggagatcgcacgccggctcgaggaacaccccgacccggccgcc
cagcaggcgggccgcgagctgcgggcccgctcaccgttctcggttcacgtcgcgctgcgg
gcactgcgacgggccgccaccctcgacctgaacggggtgctgcatcaggacctgcgactc
gcggagcacatgattcccgtcgatttcgtcgagggcgtgcgcgcgctcctgatcgacaag
gacaaccagcccgcctggcgctacgccaccctggaggacgtgcccacccgggccgtcgac
gaggtgttctcctactga

DBGET integrated database retrieval system