KEGG   Propionibacterium propionicum: HMPREF9154_3171Help
Entry
HMPREF9154_3171   CDS       T02180                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppc  Propionibacterium propionicum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    HMPREF9154_3171
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HMPREF9154_3171
   00650 Butanoate metabolism
    HMPREF9154_3171
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF9154_3171
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMPREF9154_3171
   00310 Lysine degradation
    HMPREF9154_3171
   00360 Phenylalanine metabolism
    HMPREF9154_3171
   00380 Tryptophan metabolism
    HMPREF9154_3171
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HMPREF9154_3171
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HMPREF9154_3171
   00281 Geraniol degradation
    HMPREF9154_3171
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMPREF9154_3171
   00627 Aminobenzoate degradation
    HMPREF9154_3171
   00930 Caprolactam degradation
    HMPREF9154_3171
Enzymes [BR:ppc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HMPREF9154_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3430013..3430930
Genome map
AA seq 305 aa AA seqDB search
MTDLLVTTLDDGVATLTLNRPNAINSLNLEMLQTASELLTSWAHDDSVREVVLRGEGTRG
FSAGADVRELSQAVSDRGPWLRFLEVEYLLDLIVAQFPKHITAHLNGITMGGGLGLTVNA
DRRIVDSSTLMAMPETKIGFFPDAGVMYWLARAGALGTHMALTSGTVGGGDALRINLADE
SADGDLPTPLSEAVWIQECYTGDDPVEIARRLEEHPDPAAQQAGRELRARSPFSVHVALR
ALRRAATLDLNGVLHQDLRLAEHMIPVDFVEGVRALLIDKDNQPAWRYATLEDVPTRAVD
EVFSY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgactgatctgctcgtcaccaccctggacgacggggtcgcgactctcaccctcaaccgt
cccaacgccataaactccctcaacctggagatgctccagacagcaagcgaactcctcacc
tcgtgggcccacgacgactcggtgcgggaggtggtgctccgcggcgagggaacgcgcggg
ttcagcgcgggcgctgatgtgcgggagttgtcgcaggctgtcagcgacagggggccctgg
ctgcggttcctggaggtcgagtacctgctcgacctgatcgtcgcccagttccccaaacac
atcaccgcccacctcaacggcatcaccatgggcggcggcctgggtctgacggtcaacgcc
gaccggcgaatagtcgattcgtcgacgctgatggcaatgccggagacgaaaatcggtttc
ttcccggacgcgggtgtcatgtactggctggcgcgagcgggagcgctgggcacccacatg
gcgctgacctccggcacggtcggcgggggcgacgccttgcgcatcaacctggccgacgag
tcggccgacggtgacctgcccaccccgctgtcggaggccgtctggatccaggagtgctac
accggcgatgacccggtggagatcgcacgccggctcgaggaacaccccgacccggccgcc
cagcaggcgggccgcgagctgcgggcccgctcaccgttctcggttcacgtcgcgctgcgg
gcactgcgacgggccgccaccctcgacctgaacggggtgctgcatcaggacctgcgactc
gcggagcacatgattcccgtcgatttcgtcgagggcgtgcgcgcgctcctgatcgacaag
gacaaccagcccgcctggcgctacgccaccctggaggacgtgcccacccgggccgtcgac
gaggtgttctcctactga

DBGET integrated database retrieval system