KEGG   Pelobacter propionicus: Ppro_0014Help
Entry
Ppro_0014         CDS       T00436                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ppd  Pelobacter propionicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ppro_0014
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Ppro_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
16744..18153
Genome map
AA seq 469 aa AA seqDB search
MKRAIIVGGGISGLATAWLLREKALACGIQLELVLLEKDQRPGGKIRSIHEGGYVCEWGP
NGFLDSKPQTLELCDAVGVSSDLLRSNDNARKRFIYSDGELHRLPEGGGTFLKSRLISWP
GKLRLALEPTPFIARTPAGVDESLADFARRRLGGEALDKLISPMVSGIFAGDPETMSLVS
CFPRIAQLEREYGGLIRAMVRLARQKKRERAAGKAVSSAAGPGGVLTSFRPGIQYLTDSL
AASLGGIVMADREVSWVRRGKSAAWRVGCRDGGEYDADLVIVASPAHAASAILHDCDAGI
ASILESIPYASMTVVCLGYERELVSHPLDGFGYLIPKKEGRSILGTLWDSSMFENRAPTG
KVLLRSMVGGACFPDYVHMGDDELLGRVRGDMKDVMGIVAEPSFIRIFRHPQAIPQYTVG
HGERLKHLEERLACHPGLILTGNSYRGIGLNDCVAAAQRASDQALELLR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagcgatcatcgtcggtggcggcatatccggcctggcaacggcctggctgctg
cgggagaaagcgctggcgtgcggcatacaactggagcttgtgctgctggaaaaggatcag
cggccaggggggaagatccgcagcatccacgagggtggatacgtctgcgagtggggcccc
aacggctttctggacagcaagccccagaccctggaactgtgcgacgccgtaggcgtcagc
agcgatctgctgcgcagcaacgacaatgcccgcaagcgcttcatctattccgacggagag
ctgcaccgccttcccgagggtgggggtacgttcctcaagagccgccttatttcctggccc
ggcaagctgcgcctggccctggagccgacccccttcattgcccgtacccctgcgggggtt
gacgagtccctggctgatttcgcccgccgccgcctgggaggggaagccttggacaaactg
atctcacccatggtctcgggtatctttgccggcgacccggagaccatgtcgctggtctcc
tgtttcccccgcatcgcccagctggagcgggagtacggcggcctgatcagggccatggtc
aggctggccagacagaagaagcgggaacgggccgccgggaaggcggtctcctctgctgcc
ggaccgggaggggtgctgacctccttccgtccgggtatccagtatctcaccgacagtctg
gcggcctccctgggggggatcgtcatggcggaccgggaggtgagctgggtcaggcggggg
aagagcgcggcctggagagtcggttgccgtgacggcggcgagtatgacgccgatctggtg
atcgttgcctcgccggcccatgcggccagcgccatactccatgactgtgacgcagggatc
gcttcgatcttggagagcatcccctatgccagcatgacggtggtctgcctcggctatgag
cgggagctggtcagccaccccctggacggtttcggctacctgatccccaaaaaagagggg
cgcagcatcctgggaacgctctgggactccagcatgttcgagaaccgggcgccgacggga
aaggtgctcttgcgcagcatggtgggtggggcctgttttcccgactatgtgcacatgggt
gacgacgaactgcttggccgggtcaggggggatatgaaagatgtcatgggtatcgtcgcg
gagccctctttcatccggatctttcgccatccccaagccatcccccagtacaccgtcggt
cacggggagaggcttaagcacctggaggagcggctggcttgtcatcccggcctgatcctg
accggcaactcctatcgcggcatcggcctgaacgactgcgtggctgcggcccagagggcg
tcggatcaggccctggaactgcttcgctga

DBGET integrated database retrieval system