KEGG   Pelobacter propionicus: Ppro_0236Help
Entry
Ppro_0236         CDS       T00436                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ppd  Pelobacter propionicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(226599..229574)
Genome map
AA seq 991 aa AA seqDB search
MKLHFEPNLDYQHAAIEAVADLFRGQEICRTEFTVTSGTGEQHLLAFAQNDLGIGNRLQL
LEDELLANLRDIQLRNGLRPSDSLSSGDFTVEMETGTGKTYVYLRTIFELNKRYGFTKFV
IVVPSVAIKEGTNKTLEITRDHFEGLYPAAKGYEFFQYDSSKLGQVRNFATSPNVQIMVV
TVGAINKKDVNNLYKDSEKTGGEKPIDLIRATSPIIIVDEPQSVDGGLEGRGKEALGAMN
PLCTLRYSATHVDKHHMLYRLDAVDAYEQKLVKQIEVASASVEGGNNKAFVRLLSVSNKR
GSITARVELDVQRGGQVSRAEVNVQDGDALEFVTNRAIYANCSIGEIRCAKGQELVEIRV
PGGEEWLKPGQAIGGVDEDALKRQMIRRTIKEHLDKELRLKTRGVKVLSLFFIDSVEHYR
KYDADGNQVKGKYALIFEEEYRRLIKHPDYQTLFNDVDLETEAGDVHNGYFSIDKKGAWT
ETAENNQGSRDNAERAYNLIMKEKEKLLDFETKLKFIFSHSALREGWDNPNVFQICTLRE
IGTERERRQTIGRGLRLCVNQQGERLRGFDLNTLTVIATESYQQFADNLQKEIEDDTGIR
FGIVEKHQFAAISVTDPTGKVTPLGVEQSEAIWSHLKQAGFVDHKGKVQDSLRKALKDGT
LTLPDEFKAHLPQVKEVLRKLSGRLEIKNADERTPVKTRQAVLNSEEFKALWNRIKHKTT
YRVHFDNDALLTKCAEAIRDCPPIAKTRLQWRKAELAIGKSGIDAQETSVSAPITIDEHD
IELPDLLSDLQDKTQLTRRSIVQILTDSGRLNDFKRNPQQFIELTSETINRTKRLALVDG
IRYQRLGDEHYYAQELFEQEELTGYLKNMLETEKSVYEHVVYDSSGVEKTFAEQMEKNEA
VKVYAKLPGWFKVPTPLGSYNPDWAVLIEKDGVERLYFVVETKSSLFTDDLRDKESAKIR
CGEAHFMALAVGENPAKYIKARNLDDVMAGC
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccactttgaaccgaatcttgactaccagcatgccgccattgaggcggttgcc
gacctgtttcgtggccaggaaatctgtcgtaccgagttcactgttaccagcggcaccggc
gaacaacacctgctggcctttgctcagaacgacctggggatcggcaaccgtctgcagctt
cttgaagacgaattgctcgccaaccttcgtgatatccagcttcgcaacggcttgaggcca
tcggattccctttcttcgggagattttaccgtagagatggagaccggcaccggcaagacc
tatgtctatttgcggacgattttcgagctgaacaaacgctacgggttcaccaagttcgtg
attgtggtcccctcggtagcgatcaaggagggaaccaacaagaccctggagatcaccagg
gatcattttgagggactgtatcccgccgccaagggatacgaattcttccagtatgattcc
tccaagctgggtcaagtccggaacttcgccaccagccccaacgtacagatcatggtggtg
acggttggcgccatcaacaagaaggatgtcaacaatctctacaaggatagcgagaagacc
ggcggggaaaaacctattgatctgatccgagcgacatcgccaatcatcatcgttgatgag
ccgcagagtgttgatggtggtctggaaggtcggggcaaggaggctctgggggccatgaat
ccgctctgcaccttgcggtattcggcaacccatgtggacaagcatcacatgctgtaccgc
ctggacgccgtggatgcttatgaacagaaacttgtgaaacagattgaggtcgcctcggcc
agcgttgaaggtggcaacaacaaggctttcgtgcgtctgctgtcggtttccaacaaacgg
ggcagcataaccgccagggtggaactggacgtacagcgtggcggacaggtaagccgtgcg
gaagtcaacgtgcaggacggtgatgcccttgagtttgtgaccaatcgcgccatctatgcg
aactgcagcatcggcgagatccgctgcgccaagggccaggaactggtggagatacgggtt
ccgggtggtgaggaatggttgaagccggggcaggcaatcggcggtgtggacgaggatgcg
ctcaaacgccagatgatccggcgcaccatcaaggaacacctggacaaagaactgcggctc
aagacccgtggggttaaggtgctctccctgttcttcatcgacagcgtcgagcattaccgt
aaatacgacgccgacggtaaccaggtgaaagggaagtacgccctgatattcgaggaggag
taccgccggctcatcaaacaccctgactaccagaccctcttcaatgatgtggatctggag
accgaggcaggcgatgtgcataacggctatttctccatagacaagaaaggtgcctggacg
gagaccgccgaaaacaaccaagggagccgggacaacgccgaacgcgcctataacctgatc
atgaaggagaaggaaaagctgctggattttgagaccaagctcaaattcatcttttcacac
tccgccctgcgcgagggatgggataaccccaacgtgttccagatttgcaccctgcgtgag
atcgggaccgaacgggagcgccgccagaccatcggccggggtctgcgtctttgcgtaaat
cagcagggtgagcggctgcgaggcttcgaccttaataccctgacggtcattgccaccgag
agttatcagcagtttgcggacaatctgcagaaagagattgaagatgataccggcatccga
ttcggtattgtagaaaaacaccagttcgcggcaatatcggtgaccgacccgacgggtaaa
gtgaccccgctgggagtggaacagtccgaggcgatctggagtcacctgaaacaggctggt
tttgtagaccacaagggcaaggttcaggacagcctcaggaaggccctcaaggacggcacc
ctcacgctgccggatgagttcaaggctcacttgccgcaggtgaaggaagtcttgcgcaaa
ctctccggcaggctggaaatcaagaacgccgatgagcgcacaccggtcaagacccggcag
gcggtgttgaacagtgaagagttcaaggcactctggaaccggatcaagcataaaaccacc
tacagggtacacttcgacaacgacgcattgctcaccaaatgcgccgaggcaatcagagac
tgtccgccaatagccaagacccgcctgcaatggcgcaaagctgagcttgccatcggcaaa
tcaggcatcgatgcacaggagacctcggtttctgcccccatcaccatcgatgagcacgat
attgaattgccggatctgctgtcggatcttcaggacaagacccagctgacccggcgcagc
attgtacagattcttaccgatagcggccggttgaatgatttcaagcggaacccgcagcaa
tttattgaactgacttcggagacgatcaatcgaaccaagcgtttggccctagtggacggc
atccgttaccagcgtctgggggatgagcactactacgctcaggagctgttcgagcaggaa
gagttgaccggctatctgaagaacatgcttgagacggaaaagtcggtgtatgagcatgtc
gtttatgattcttccggtgttgagaaaacctttgccgaacagatggagaagaacgaagcg
gtaaaggtctatgccaaacttccgggctggttcaaggtgccgactccgctgggcagttac
aaccccgattgggccgtgctgatcgaaaaggacggcgtggaacggctgtatttcgttgtc
gaaaccaagagcagcctctttacagatgatcttcgcgataaggaaagtgcaaagatcaga
tgcggcgaagcgcattttatggctttggctgtaggtgaaaatccggcgaagtatatcaag
gctcggaatcttgatgatgtgatggctgggtgttga

DBGET integrated database retrieval system