KEGG   Pelobacter propionicus: Ppro_0260Help
Entry
Ppro_0260         CDS       T00436                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppd  Pelobacter propionicus
Brite
Enzymes [BR:ppd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ppro_0260
Secretion system [BR:ppd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ppro_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(258019..258771)
Genome map
AA seq 250 aa AA seqDB search
MKTANNKKLMVGGLMMVIMTAAGFSMANENLRTEKDALMKTFPNLKMDGFRESPLKGLYE
ITAGDQVFYFSPEGYLFFGELWTKDGKNLTAEMREKVATERINSLPLDKALKVGNGPKKV
IEFTDPDCPYCRKVDGYLAKRTDVTRYIYFVPLRRIHPDAEKKARYILSQSDRNKAFHDV
FTGQLDGKPISIAEDAQQQQLEEMEKIAAGIGIRGTPALWIEGAHVNGADIQLISRLLDE
GKEVSKPQSH
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccgcaaacaacaagaaacttatggtcggcgggctgatgatggtcatcatgact
gcggcgggtttctctatggctaacgaaaatctgagaacggagaaagatgccctgatgaag
acctttccaaatttgaaaatggacggcttcagggaatcgccgctcaaaggcctatatgag
atcaccgcaggcgaccaggtgttttacttcagccctgaaggatacctgttttttggtgaa
ttatggaccaaagacggcaagaacctgacagccgagatgcgggagaaggttgccactgaa
cgaatcaacagtctcccccttgataaggccctgaaagtcggcaatggcccgaaaaaggtc
atcgagttcaccgaccccgactgtccctattgccgcaaggtggacggctatcttgcgaag
cgtaccgatgtgacgcgctacatttatttcgtcccgctccgcagaatccatcctgacgcc
gaaaagaaggcccgttacatcttgtcccaatctgatcggaacaaggcattccatgatgtt
tttaccggtcaactggacggcaaaccgatttccatcgccgaagatgcgcagcaacagcaa
ctggaggaaatggagaagatcgctgccgggattggaatacggggaacaccggctctctgg
atcgaaggtgctcacgtgaatggtgcggacatccaactgatatccagattgcttgacgag
ggaaaggaggtaagcaagccacaatcgcactga

DBGET integrated database retrieval system