KEGG   Pelobacter propionicus: Ppro_0322Help
Entry
Ppro_0322         CDS       T00436                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ppd  Pelobacter propionicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppro_0322
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_0322
   00020 Citrate cycle (TCA cycle)
    Ppro_0322
   00620 Pyruvate metabolism
    Ppro_0322
   00640 Propanoate metabolism
    Ppro_0322
   00650 Butanoate metabolism
    Ppro_0322
  Energy metabolism
   00680 Methane metabolism
    Ppro_0322
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ppro_0322
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ppro_0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
322322..322897
Genome map
AA seq 191 aa AA seqDB search
MTDTIEIRWHGRGGQGTVTACKLFADACLNGGRFVQAFPEYGPERAGAPIRAYNRVSARE
LRGHYPVIRPNIVVVVDETLLESIDVTEGAPADAAFIINCRGNAADMRNRIQAGPTQKVV
TVDATRIAIDTIGRPMPNAPLIGCVTRVSGMLSLQAALDDMARSFEKKFSQQIISGNLEA
TRRGFDEAVEQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatacaatcgagattcgttggcatggacggggcggacagggtacggttaccgcc
tgcaagctgttcgccgacgcctgccttaacggtggacgctttgtgcaggccttcccggag
tacgggccggaacgggccggcgctcccatccgggcctacaaccgggtcagcgcccgggag
ctcagggggcactacccggtgatccgtcccaacatcgtcgtggttgtcgatgagaccttg
ctggagagcatcgatgtcaccgaaggcgctcccgctgacgcagccttcatcatcaactgc
cgcgggaatgccgcggacatgcgcaacaggatacaggccggcccgacccagaaggtcgtt
acggtggacgccaccaggattgccatcgataccatcggccgtcccatgcccaacgcgccg
ttgatcggctgcgtcaccagggtctccggcatgctcagcctgcaggccgccctggacgac
atggcacggagcttcgaaaagaagttcagccaacagatcatctcgggaaaccttgaagcg
accagacggggtttcgatgaggcggtggagcaatga

DBGET integrated database retrieval system