KEGG   Pelobacter propionicus: Ppro_0322Help
Entry
Ppro_0322         CDS       T00436                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00010  Glycolysis / Gluconeogenesis
ppd00020  Citrate cycle (TCA cycle)
ppd00620  Pyruvate metabolism
ppd00640  Propanoate metabolism
ppd00650  Butanoate metabolism
ppd00680  Methane metabolism
ppd01100  Metabolic pathways
ppd01120  Microbial metabolism in diverse environments
ppd01130  Biosynthesis of antibiotics
ppd01200  Carbon metabolism
Module
ppd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_0322
   00020 Citrate cycle (TCA cycle)
    Ppro_0322
   00620 Pyruvate metabolism
    Ppro_0322
   00640 Propanoate metabolism
    Ppro_0322
   00650 Butanoate metabolism
    Ppro_0322
  Energy metabolism
   00680 Methane metabolism
    Ppro_0322
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ppro_0322
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ppro_0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MukB_hinge
Motif
Other DBs
NCBI-ProteinID: ABK97956
UniProt: A1AKT6
Position
322322..322897
Genome map
AA seq 191 aa AA seqDB search
MTDTIEIRWHGRGGQGTVTACKLFADACLNGGRFVQAFPEYGPERAGAPIRAYNRVSARE
LRGHYPVIRPNIVVVVDETLLESIDVTEGAPADAAFIINCRGNAADMRNRIQAGPTQKVV
TVDATRIAIDTIGRPMPNAPLIGCVTRVSGMLSLQAALDDMARSFEKKFSQQIISGNLEA
TRRGFDEAVEQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatacaatcgagattcgttggcatggacggggcggacagggtacggttaccgcc
tgcaagctgttcgccgacgcctgccttaacggtggacgctttgtgcaggccttcccggag
tacgggccggaacgggccggcgctcccatccgggcctacaaccgggtcagcgcccgggag
ctcagggggcactacccggtgatccgtcccaacatcgtcgtggttgtcgatgagaccttg
ctggagagcatcgatgtcaccgaaggcgctcccgctgacgcagccttcatcatcaactgc
cgcgggaatgccgcggacatgcgcaacaggatacaggccggcccgacccagaaggtcgtt
acggtggacgccaccaggattgccatcgataccatcggccgtcccatgcccaacgcgccg
ttgatcggctgcgtcaccagggtctccggcatgctcagcctgcaggccgccctggacgac
atggcacggagcttcgaaaagaagttcagccaacagatcatctcgggaaaccttgaagcg
accagacggggtttcgatgaggcggtggagcaatga

DBGET integrated database retrieval system