KEGG   Pelobacter propionicus: Ppro_0325Help
Entry
Ppro_0325         CDS       T00436                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
ppd  Pelobacter propionicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppro_0325
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_0325
   00020 Citrate cycle (TCA cycle)
    Ppro_0325
   00620 Pyruvate metabolism
    Ppro_0325
   00640 Propanoate metabolism
    Ppro_0325
   00650 Butanoate metabolism
    Ppro_0325
  Energy metabolism
   00680 Methane metabolism
    Ppro_0325
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ppro_0325
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ppro_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
324365..325300
Genome map
AA seq 311 aa AA seqDB search
MLTPLNLRELSRKEELFAPGHRMCTGCGAPIVVRMVMMAAQYPLVVANATGCLEVSTSID
GFTSWKTPWIHSAFENAAATLAGVETMYRSLRKQGKLADDIRFVAFGGDGGTADIGFQSL
SGAMERGHDLTYICYDNGAYMNTGIQRSSATPFGADTATSPVGSVSTGKPQQAKDMTRIM
AAHGIPYVAQASPSHWQDLMKKVRKALEIRGPKFINVIAPCNRGWRTGTDDAIQLSRLAV
ETCYWPLYEVENGVTRITVTSREKKPLTEFLKPQGRFKHLFKPGNEQLLAEAQSQVDACW
QRLQREQAMGL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgctgacaccactcaacctgagggaactgtcccggaaagaggaactgttcgcccccggt
caccgcatgtgcaccggctgcggcgcgcccatcgtggtcaggatggtcatgatggctgcc
cagtacccgctggtggtggccaacgccaccggctgcctggaggtctccaccagcatcgac
ggcttcacctcctggaaaactccctggatacacagcgcctttgaaaacgcggccgccact
ctggcaggggtggagaccatgtaccggtcgctcaggaaacagggcaagctggccgacgac
atacggttcgtggccttcggcggggacgggggaaccgccgacatcggcttccagagcctg
tccggtgccatggagcgcggccacgacctgacctacatctgctacgacaatggcgcctac
atgaacaccggcattcagcgctcctcggccacccccttcggcgccgacaccgccaccagc
ccggtgggaagtgtgagcacgggcaagccgcagcaggctaaggatatgaccaggatcatg
gctgcccacggcatcccttacgtggcccaggcatcgcctagccattggcaggacctgatg
aagaaggtccgcaaggccctggagatcaggggtcccaagttcatcaacgtcatcgccccc
tgcaaccgcggctggcggaccggcaccgacgatgccatccagctctcccgcctggcggtg
gaaacctgctactggccgctgtacgaggtggagaacggggtcacccgcatcacggtcact
tcccgggagaagaagccgctgaccgagttcctgaaaccacagggacgtttcaagcacctg
ttcaaaccgggcaacgaacagctcctggcggaagcccagagccaggttgatgcctgctgg
cagcggctgcagcgggaacaggccatgggcctgtaa

DBGET integrated database retrieval system