KEGG   Pelobacter propionicus: Ppro_0465Help
Entry
Ppro_0465         CDS       T00436                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00030  Pentose phosphate pathway
ppd01100  Metabolic pathways
ppd01120  Microbial metabolism in diverse environments
ppd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ppro_0465
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Ppro_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABK98097
UniProt: A1AL77
Position
complement(487186..488916)
Genome map
AA seq 576 aa AA seqDB search
MDKIYRVNMTDLTVKQEDVPAEWALLGGRGLTSTIVAAEVPPTCHPLGPNNKLVFAPGLL
TGTPAAQSGRLSAGAKSPLTGGINESNSGGTAAQLLARLCIKALIIEGQPKEDKWFNLHV
NKDGITIQEETELVGQNNFAIIDAVETRLGKKTGILTIGIAGELRMAAADISVKDPDSKL
RSHGRGGLGAVMGSKKIKFISIDGEGAPGVTIAAPDKFKAASRVFAKALLDHPVSGQALP
TYGTNVLVNIINEAGGLPTRNFSYGQFASHDKISGETMHDTIVARGGKPKHGCHAGCIIQ
CSQVYLDQDGKYLSSGFEYETIWALGANCCIENLDIIAKADNIMDDIGIDSIETAVMFGV
AMEAGIIPFGDGEGVLRLLTDEIAKGTPLGRILGGGAGSVGRAYGVIRVPVVKNQSIPAY
DPRSIKGIGITYATSTMGADHTAGYSIATNILNVGGNVDPLKKEGQVELSRNLQIATAAI
DSTGMCIFVAFPALDIPECLPALIDMLNARFDSSLAGDDFVALGKQILKVERKFNIEAGF
NSAHDRLPEFFTYEPLPPHNVVWDFSDEEIDEFWNF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatctatcgcgtaaatatgaccgatttgacggtcaaacaggaagacgttccc
gcagagtgggcactactcggtggccgcggattgacctcaactatcgtagctgccgaggtt
ccgccgacctgccatcctctcgggccgaacaacaaactggtgtttgccccgggccttctc
accggtacaccagcagcccagtccggacgtctctccgcgggcgccaagagcccgctcacc
ggaggcattaatgagagcaactccggcggtaccgcggcacaactgctggcacgactttgt
atcaaggcactgatcatcgaaggtcagccaaaggaggacaaatggttcaacctgcacgta
aacaaggacggtatcaccatccaggaggaaaccgaactcgtcggccagaacaactttgcc
atcattgatgccgttgagactcgtctgggcaaaaaaaccggcatcctgaccataggtatt
gctggtgaactcagaatggcagcggcagatatttcggtcaaggatcctgacagcaaactc
cgtagccacggccgcggaggcctcggcgcggttatgggttccaagaagatcaagttcatc
tccatagacggcgaaggtgcacccggtgtcacgattgccgccccggataaattcaaggct
gcctcacgagtctttgccaaagccctgctcgaccacccggtcagcggtcaggccctcccc
acctatggcaccaacgttctggtaaatatcatcaacgaggccggaggattgccgacccgc
aacttctcttacggtcagtttgcttcgcatgacaagatctccggcgaaaccatgcacgac
acaatcgttgcccgtggtggcaaaccgaaacatggttgccatgccggttgcatcatccag
tgctcgcaggtctaccttgaccaggacggaaaatatctttcatccggtttcgaatatgag
accatctgggctctcggtgccaactgttgtatcgaaaatctggatatcatcgcgaaagcc
gacaatatcatggacgatatcggtatcgactccattgaaaccgcagtcatgttcggcgtg
gcaatggaagccggcatcatcccttttggcgacggcgagggagtacttcgcctgctcacg
gatgaaatcgccaagggtacaccgctcggccgcatccttggtggcggtgccggttctgtg
gggcgtgcctacggtgtcatccgtgttcctgtcgtgaagaaccagagcattccggcctat
gacccccgttcaatcaaaggcatcggtatcacctatgcgaccagcaccatgggggccgac
cacaccgcgggttactccattgcaaccaatatcctcaatgtcggcggcaacgttgatccg
ctcaagaaggaaggccaggttgagctttcccgaaacctgcagatcgcaaccgccgcgatt
gactccaccggcatgtgtatcttcgtggcctttcccgccctcgatattcctgaatgcctg
ccggccctgatcgacatgctcaacgcccgcttcgacagctcccttgccggcgacgacttt
gttgcccttggcaagcagatcctcaaggtcgaacgaaaattcaacatcgaagccgggttc
aacagtgctcacgaccgcttgcccgagttcttcacatacgaacccttaccgccgcacaac
gttgtctgggacttctccgacgaagaaatcgatgagttctggaacttctaa

DBGET integrated database retrieval system