KEGG   Pelobacter propionicus: Ppro_0481Help
Entry
Ppro_0481         CDS       T00436                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00040  Pentose and glucuronate interconversions
ppd00052  Galactose metabolism
ppd00500  Starch and sucrose metabolism
ppd00520  Amino sugar and nucleotide sugar metabolism
ppd01100  Metabolic pathways
ppd01130  Biosynthesis of antibiotics
Module
ppd_M00362  Nucleotide sugar biosynthesis, prokaryotes
ppd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ppro_0481
   00052 Galactose metabolism
    Ppro_0481
   00500 Starch and sucrose metabolism
    Ppro_0481
   00520 Amino sugar and nucleotide sugar metabolism
    Ppro_0481
Enzymes [BR:ppd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ppro_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: ABK98112
UniProt: A1AL92
Position
503287..504150
Genome map
AA seq 287 aa AA seqDB search
MKVRKAVFPVAGLGTRFLPATKSSPKEMLPLIDKPLVQYVVEEAVASGIEQVLFVTGRGK
RSIEDHFDISVELEAHLNGQGKARELSSVRRIAEMAEIFYVRQRQALGLGHAILCARDFI
GNEPFAVLLGDDIIDSQRPCLRQLLDVFEEHNGSVLALEKVPMENISSYGCVRATALSDR
VFDVLDMVEKPSRAEAPSDMAIIGRYVLTPAIFDILMQQQPGKGGEIQLTDAVLTLSKEE
KVYGCLFEGLRHDCGDKLGFLKATVDMALKRDEFREELSAYLRERLG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcagaaaagccgttttccccgttgccggactgggcacccgatttcttcccgcc
acaaagtcgtcgccaaaggagatgctgccgctgatcgacaaaccgctggtacagtatgtg
gtggaggaggcggttgcctcgggcatcgagcaggtcctgttcgtcaccggccgcggcaag
cgctccatcgaggaccacttcgacatctccgtggagttggaggcgcatctcaacggccag
ggcaaggcgcgggaactgtccagtgtccgcaggatcgccgagatggcggagatcttctac
gtgcgccagcgccaggcgctgggtcttggccacgccatcctctgcgccagggatttcatc
ggcaacgaaccctttgccgtgctgctgggtgatgacatcatcgacagccaacgcccctgt
ctgcgccagttgctggatgtgttcgaagagcacaacggctcggtgcttgccctggaaaag
gtgccgatggagaatatctcatcctatggttgcgtgcgtgccaccgccctgtccgatcgg
gtcttcgacgtgctggatatggtggagaagccgagtcgggcggaagccccctcggatatg
gccatcatcggtcgctacgtgctgaccccggccatattcgacatcctcatgcaacagcag
ccgggcaaggggggcgagatacagctcaccgacgcggttctgaccctgtccaaggaagaa
aaggtctatggttgtctgtttgaggggttgcgccacgattgcggcgacaagctgggattt
ctgaaggcaacggttgatatggccctgaagcgggacgagtttcgcgaggagctttcggcg
tatcttcgtgagcggctggggtga

DBGET integrated database retrieval system