KEGG   Pelobacter propionicus: Ppro_0649Help
Entry
Ppro_0649         CDS       T00436                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppd  Pelobacter propionicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppro_0649
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_0649
   00052 Galactose metabolism
    Ppro_0649
   00500 Starch and sucrose metabolism
    Ppro_0649
   00520 Amino sugar and nucleotide sugar metabolism
    Ppro_0649
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ppro_0649
   00524 Butirosin and neomycin biosynthesis
    Ppro_0649
Enzymes [BR:ppd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ppro_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
687825..688802
Genome map
AA seq 325 aa AA seqDB search
MTERNTLAIAVDIGGTNLRFALVDAAGCVLSRNRTLSRIDHGRDPFCRRLLEGISGMEHE
ASARGASVVGIGVGVPGLVGRDGMIHASVNMRPLDGFVLSRFLEQQTSLPSTCDNDANLI
ARGEAAHGAGRGLHSFVVITLGTGVGSGLVLDGRIWNGVGGFAAEFGHVTVEPEGAPCSC
GNRGCLEQYASASAIARIAGELIKGGQVDDASPLDAARVARLARQGWVEAQTAFEVAGRY
LGIALASLTTTLNLEAAIICGGVAPSLELMRPSLVNELRMRCFSQILADFSILRGELGDD
AGLLGAAATIRARAAHDVPGDSLAT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaggaacactctcgccatagccgttgatatcggcggcaccaatctccgcttc
gccctcgtggatgccgccggttgcgttctctcccgcaaccggactctcagtcgtatcgac
catggccgcgaccccttctgccgtcgcctcctggagggaatctccgggatggagcacgag
gcttccgcgaggggggcgtccgtcgtcggtattggcgtcggtgtgcccggactcgttggc
agggatggaatgatccatgcctcggtcaacatgcgccccctggacggttttgtcctgtcc
agatttctggaacagcagacttcactgccgtccacatgcgacaatgacgccaacctcatc
gcccggggagaggcagcccacggtgccggtcgcgggctgcactccttcgtggtgatcacc
ctcggaacgggggtggggagcgggcttgttctcgacggtcggatctggaacggtgtcggc
ggttttgccgcggaattcggccatgttacggttgagccggaaggggcgccctgtagctgc
ggcaacaggggctgtctggaacagtatgcctcagccagcgcgattgcccgcatcgcgggg
gaactcatcaagggggggcaggtggatgatgcctccccgctggacgcggcccgggtcgcc
cgactggcccgccaggggtgggtggaggcgcagacggcattcgaggtggctggccgctat
ctggggattgccctggcctcgttgaccacgaccctcaacctggaggcggcaatcatctgc
ggcggcgtggcgcccagtctggagttgatgcgcccctccctggtcaatgaactgcggatg
cgctgtttttcccaaatccttgccgatttttcaatcctgcggggcgaactgggtgacgac
gccgggttgctgggggcagccgcgacaatacgtgccagggccgcccatgatgtccctggt
gactccttggccacttga

DBGET integrated database retrieval system