KEGG   Pelobacter propionicus: Ppro_0649Help
Entry
Ppro_0649         CDS       T00436                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00010  Glycolysis / Gluconeogenesis
ppd00052  Galactose metabolism
ppd00500  Starch and sucrose metabolism
ppd00520  Amino sugar and nucleotide sugar metabolism
ppd00521  Streptomycin biosynthesis
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01120  Microbial metabolism in diverse environments
ppd01130  Biosynthesis of antibiotics
ppd01200  Carbon metabolism
Module
ppd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_0649
   00052 Galactose metabolism
    Ppro_0649
   00500 Starch and sucrose metabolism
    Ppro_0649
   00520 Amino sugar and nucleotide sugar metabolism
    Ppro_0649
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ppro_0649
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ppro_0649
Enzymes [BR:ppd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ppro_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABK98280
UniProt: A1ALR0
Position
687825..688802
Genome map
AA seq 325 aa AA seqDB search
MTERNTLAIAVDIGGTNLRFALVDAAGCVLSRNRTLSRIDHGRDPFCRRLLEGISGMEHE
ASARGASVVGIGVGVPGLVGRDGMIHASVNMRPLDGFVLSRFLEQQTSLPSTCDNDANLI
ARGEAAHGAGRGLHSFVVITLGTGVGSGLVLDGRIWNGVGGFAAEFGHVTVEPEGAPCSC
GNRGCLEQYASASAIARIAGELIKGGQVDDASPLDAARVARLARQGWVEAQTAFEVAGRY
LGIALASLTTTLNLEAAIICGGVAPSLELMRPSLVNELRMRCFSQILADFSILRGELGDD
AGLLGAAATIRARAAHDVPGDSLAT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaggaacactctcgccatagccgttgatatcggcggcaccaatctccgcttc
gccctcgtggatgccgccggttgcgttctctcccgcaaccggactctcagtcgtatcgac
catggccgcgaccccttctgccgtcgcctcctggagggaatctccgggatggagcacgag
gcttccgcgaggggggcgtccgtcgtcggtattggcgtcggtgtgcccggactcgttggc
agggatggaatgatccatgcctcggtcaacatgcgccccctggacggttttgtcctgtcc
agatttctggaacagcagacttcactgccgtccacatgcgacaatgacgccaacctcatc
gcccggggagaggcagcccacggtgccggtcgcgggctgcactccttcgtggtgatcacc
ctcggaacgggggtggggagcgggcttgttctcgacggtcggatctggaacggtgtcggc
ggttttgccgcggaattcggccatgttacggttgagccggaaggggcgccctgtagctgc
ggcaacaggggctgtctggaacagtatgcctcagccagcgcgattgcccgcatcgcgggg
gaactcatcaagggggggcaggtggatgatgcctccccgctggacgcggcccgggtcgcc
cgactggcccgccaggggtgggtggaggcgcagacggcattcgaggtggctggccgctat
ctggggattgccctggcctcgttgaccacgaccctcaacctggaggcggcaatcatctgc
ggcggcgtggcgcccagtctggagttgatgcgcccctccctggtcaatgaactgcggatg
cgctgtttttcccaaatccttgccgatttttcaatcctgcggggcgaactgggtgacgac
gccgggttgctgggggcagccgcgacaatacgtgccagggccgcccatgatgtccctggt
gactccttggccacttga

DBGET integrated database retrieval system