KEGG   Pelobacter propionicus: Ppro_0724Help
Entry
Ppro_0724         CDS       T00436                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K03406  
methyl-accepting chemotaxis protein
Organism
ppd  Pelobacter propionicus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ppro_0724
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Ppro_0724
Bacterial motility proteins [BR:ppd02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ppro_0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
759359..760978
Genome map
AA seq 539 aa AA seqDB search
MSKFSIGTRLLAGFSFVLILLAVIIATGVNSLNKSEDQLKNVKRISGLSNKVVVATIADK
DIQELVKGLIMVDLSAERGRVVASIRELEQKCAEAVDVLDKNTKTPDGKKLVAEVKAARE
EVARVDEKLITLAISGDSAGFKAMMNVEGEKAIARSSSALDALLSFYDKRVGVRVDDAID
NAAYATRLMFGLGIAAILLGILAAVFITRSITVPLHTCVEMADKIADGDMSISMRVEDGK
CETVHLIKAIANMAERIRDAIGRVSLAAGEVSAAVTELHENSQRMVRGTDEVSSQASMVA
TAGEEMAATSLDIANNCNSAAESSRHANQLATSGASIVQGTVDGMARIAERVRATARSVE
NLGSRSDEIGAIVGTIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAERTTR
ATKEIGGMIKAIQTETHQAVLSMDEGVNEVERGTQEASKSGSALEEILAQINEVTNQINQ
IATAAEEQSSTSRDISNNMHMITGIVNETAQGTQATAKAADQLTALANDLKVLVAQFRL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatttagcatcggaacccgtctgctggcaggattttcgtttgttctgatactt
ctggccgttatcatcgccacaggggtcaacagccttaacaagagcgaggatcagctgaag
aatgtcaaacgtatcagcggcctgagcaacaaggtagtggttgcgaccatcgccgacaaa
gatattcaggagttggtgaaggggctgataatggttgacctgagcgctgagagggggcgg
gtcgtcgccagcatacgcgaactggagcagaagtgcgcggaagcggtggatgtgctggac
aaaaacaccaaaacaccggatggcaagaagcttgtggccgaggtgaaggcagcccgtgag
gaagttgccagagtggatgaaaaactcatcaccctggcgatcagtggtgacagtgccggg
tttaaggcgatgatgaatgttgaaggagaaaaggcgattgccaggtcatcatcggcgctt
gacgctctgctgtcgttctacgacaaacgtgtgggagttcgcgtagatgatgcgatcgac
aatgccgcctacgcaacccgactgatgtttggtctgggcatcgcagccatcctcctggga
attctggcagccgttttcatcacgcgcagcattacggtgccattgcacacctgtgtggag
atggccgacaagattgccgatggtgacatgtccatttccatgagagtcgaagacggcaaa
tgcgaaacggtgcatctcatcaaggccatagcaaatatggcagagagaattcgcgatgcc
atcggccgtgtttccctggctgccggcgaggtctccgccgctgttacggaactgcatgaa
aattcgcaacgcatggtacgggggactgatgaggtttcctcccaggcttccatggttgcc
actgccggtgaggaaatggcagccacatctctggatatcgccaacaactgcaactccgca
gccgagagctcgcgccatgccaatcagcttgctaccagcggagcttccattgtccagggg
accgttgacgggatggcccgcatcgccgagcgggtccgtgccacggcgcgcagtgtcgag
aatctcggctcacgctcggacgagatcggcgccattgttggcaccatcgaggatatcgcg
gatcagaccaatctgttggcactcaacgcggcaatcgaggcggcccgcgccggagaacag
gggcggggattcgcggtggtcgccgacgaggttcgcgccctcgccgaacgtacgacccgt
gcgaccaaggagatcggcggtatgatcaaagctatccagaccgagacgcaccaagcggtt
ctttctatggatgagggcgtcaacgaggtggagagaggtacgcaagaagcgtccaagtcc
ggcagtgcactggaggagattcttgcgcagatcaacgaggttaccaaccagatcaaccag
attgccaccgctgcggaagaacagagctcaaccagtcgcgacatcagcaacaacatgcat
atgatcaccggaattgtcaatgaaaccgcacagggaacccaggcaaccgccaaggccgca
gaccagttgacggctcttgccaatgacctgaaggtgcttgttgcccagttcaggctgtag

DBGET integrated database retrieval system