KEGG   Pelobacter propionicus: Ppro_0738Help
Entry
Ppro_0738         CDS       T00436                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ppd  Pelobacter propionicus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ppd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
777229..778071
Genome map
AA seq 280 aa AA seqDB search
MKSLTLKAPAKVNYLLDVIRRRPDGYHDLRMVMQRVNLCDEIAIALTDSPELSVCCGKDG
VPDGPGNIAWKAARAMLDLAAGGQGATISIVKNIPVAAGLGGGSSDAATVLMGMNQLLEL
GLTDQELMRIGVKLGADVPFFIFKKTALAEGIGEQLRAMPPMPALWVLLVNPGVHVSTAW
VYKNLRLTSRGELAKLPQFFSTVEDVCSMLSNDLESVTIPAFPVIADIKRAMLAKGALGA
MMSGSGPTVFGLFRDREGAEAARAELVEGSGWFAAVAETL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagcctgacactcaaagccccagccaaggtcaactatctgctggatgtcattcga
cgccgccccgatgggtaccatgacctgcgcatggtcatgcagcgggtcaacctgtgtgac
gagatagccatcgctctgaccgacagcccggaactgtccgtgtgctgcggaaaagacggc
gtgcctgacggtcccggcaatatcgcctggaaagcggcccgcgccatgctggatctggcc
gccggcggacagggggcgaccatctccatcgtcaagaacatcccggtggccgccggcctg
ggtggcggcagcagtgatgcagccacggtgctgatgggaatgaaccaacttctggagctg
gggctcacggatcaggaactgatgcgcatcggcgtcaagctgggcgctgatgtgccgttc
tttattttcaaaaaaacagccctggccgaagggatcggcgagcagttgcgggccatgccg
cccatgcccgcgctctgggtgctgctggtgaatccgggtgtgcatgtctcgacagcctgg
gtgtacaaaaatttgcggttgacaagccgtggcgagctggctaaactcccccagtttttc
agcacggtcgaggacgtttgctccatgctttccaacgatctggagtcggtgaccattcct
gctttcccggtgatcgccgacatcaagcgcgccatgctggccaagggtgccctgggtgcc
atgatgtccggcagcggccccacggtcttcgggctcttccgcgaccgggagggtgcggaa
gcggcccgtgcggaactggtcgaggggagtggatggttcgcggcggtggctgagactctc
tga

DBGET integrated database retrieval system