KEGG   Pelobacter propionicus: Ppro_1190Help
Entry
Ppro_1190         CDS       T00436                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ppd  Pelobacter propionicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1241699..1242766
Genome map
AA seq 355 aa AA seqDB search
MSGLFWYYRDCPRQSRPRLVRASDTQEHMKTFITGATGFIGASIVRELLKEGRQVRALVR
PSSDTSNLAGLDVEFWKGDLRDRDSLVSGLKGCDVLYHAAADYRLWTRNPAEMYRINVDG
TAAILDAALKNGLSRVVYTSSVGTLGNPGDGTPGSEDAPVTLNDMVGHYKKSKFLAEREA
DTFVARGLPLVIVNPSTPIGPLDIKPTPTGKIIVDFLNRRMPAYLDTGLNIIAVEDCARG
HLLAEKRGQVGRKYILGNSNLTLADIFKLLNRITGLPAPRLRLPYTPILLAAYVNEGLSR
ITGREPLIPLAGVQMAAKFMFFDSSRAVRELGLPQSSVEDALRRAVEWFRANRYA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggcctgttttggtactaccgcgattgtccgcggcaatcccgtccacggctggtc
cgtgcgtcggatacacaggagcatatgaagactttcatcaccggcgccaccgggttcata
ggcgcaagtattgtcagggaactattgaaggaggggcgccaggtgcgcgccctggtgcgc
cccagttcggatacctccaacctggccggactggacgtggagttctggaagggggacctg
cgcgaccgggacagcctggtgagcggtttgaaggggtgcgacgtgctttaccacgcggcc
gccgattaccgcctctggacgcgcaaccccgccgagatgtaccgcatcaacgtggatggc
acggccgccattctggacgctgccctgaaaaacggcctctcccgcgtggtctacaccagc
agcgtggggaccctgggcaatccgggggacggcactccgggaagcgaggatgcgccggtc
accctgaacgacatggtcggacattacaagaagagcaagttcctggccgagcgcgaggcg
gatacgttcgtggccagggggttgccgttggtcatcgtcaatccctcaacccccatcggc
cctctggacatcaagccgacccccaccggcaagatcatcgtcgacttcctgaaccgcagg
atgccggcctatctggatacgggactcaacatcatcgcggtggaggattgcgcccgtggc
cacctcttggcggagaagcggggccaggtgggcagaaagtacatcctgggcaacagcaac
ctgaccctggccgacatcttcaagctgctgaacaggataaccggactgcccgccccccgg
ttgcggcttccctatacgccgatcctgctggccgcttatgtcaatgagggactctcccgg
attacgggcagggaaccgctgatccctctggccggggtgcagatggcggcgaagttcatg
ttcttcgactcatcccgtgcggtcagggagctggggctgccccagtcgtcggtggaggat
gccctgcggcgcgccgtggagtggttcagggccaaccggtatgcgtga

DBGET integrated database retrieval system