KEGG   Pelobacter propionicus: Ppro_1261Help
Entry
Ppro_1261         CDS       T00436                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ppd  Pelobacter propionicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1324088..1326157
Genome map
AA seq 689 aa AA seqDB search
MYGNVYPMAALVGQETLRQSLLIGAVNPAVGGILIRGEKGTAKSTAVRALAALLPEMDVV
EGCEFSCDPDSPEFQCDDCRSRNGDFGIVKRRVKVVDLPLNATEDRVVGGLDFGRAIRQG
KRFLAPGLLAEAHRGILYVDEVNLLDDHIVDIVLDAAASGENVLEREGLSFRHPSRFMLV
GTMNPEEGELRPQLLDRFGLCVEVEAARSLEERVTLMLRRDAFDTDGAAFQQNYREPNER
IARRIREARDLLPRVRMPRQLRGFIAELCVENNVAGHRADLVLEQAALGLSALEQRLEVT
VDHITRVAPLVLAHRRRDAQAPPPPPPPPPRDQEQEQQEQQEQQEDERQQEQEREQSPDR
QPEQAEGQEQREQREDRENRDDAGEEEEQSEQENSDMPHPPSQGEERESVFQVGATFKVK
TIRSDKDRVVRRGSGRRSSTRVSRKQGRYVKSSYACSNNDIALDATLRAAAPHQLFRGTK
EGMCVNLSDRDFRGKVREKRVGNFLLFVVDASGSMGARGRMAASKGAVMSLLLDAYQKRD
RVGMISFRKNEAFVNLPPTTSVELAGKLLEEMPVGGRTPLSAAIAKSYEQLRGVLGRDPT
ARPIVIFITDGKSNVALGDGRPVDEAMGLARAMAVKEERARYIVVDTEEEGMVSFGLARR
LADAMEAEYFRIDQLKAQSLVNIVKQRMD
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaaacgtgtacccgatggccgctctggtggggcaggagaccctcaggcagagc
cttttgatcggcgcggtcaatcccgccgtggggggcatcctgatccggggggagaagggg
accgccaaatcaaccgccgtgcgcgccctggcggccctgctgccggagatggacgtggtg
gagggatgcgaattttcctgcgatccggacagccccgagttccagtgcgatgactgccgt
tcccgcaacggtgatttcggcattgtcaaacgtcgggtcaaggtggtcgacctccccctg
aacgccacggaggaccgtgtggtgggggggcttgacttcggcagggccatccgtcagggg
aaacgcttcctggcgcccggactgctggccgaggcccatcgcggcatcctctacgtggac
gaggtcaacctgctggacgatcatatcgtggatatcgtcctggatgcagccgcatcgggc
gaaaacgtcctggaacgggaggggctgtcgtttcgccatccgtcccggttcatgctggtg
ggaaccatgaacccggaggagggggagctgaggccgcagctcctggaccgtttcgggctc
tgcgtggaggtggaagcggcccggagtctggaggagcgggtcaccctgatgctgcggcgg
gacgccttcgatactgacggcgcggcctttcagcaaaactaccgtgagcccaacgaacgg
atagcccggcggatcagggaggcgcgcgacctgctcccccgggtccgcatgcccagacag
ctgcgcggcttcatcgccgagttgtgcgtcgagaacaacgtggccggccaccgggccgat
ctggtcctggaacaggctgccctggggctgtcggccctggaacagaggctggaggtgacg
gtcgaccatatcaccagggtggcgccgctggtgctggcccaccgcagacgggacgcccag
gcgcctcccccccctccaccgccgcctccccgggatcaagagcaggaacaacaggaacaa
caggaacaacaggaggacgaacggcagcaggaacaggagcgggaacagagcccggatcgg
cagcctgaacaggctgaggggcaggaacaacgggaacagagggaggatcgggaaaaccgg
gatgatgccggggaggaagaagagcagtccgaacaggagaacagcgacatgccgcaccct
ccttctcaaggggaagagcgggagagcgtcttccaggtaggcgcgaccttcaaggtcaag
accatcaggagcgacaaggaccgcgtcgtccgcagggggtcgggccggcgctccagcacc
cgcgtgagccggaaacaggggcgctacgtgaagagcagttatgcctgctccaacaatgac
atcgccctggacgccaccctgcgggccgccgctccccaccagctgttcaggggcacgaag
gagggaatgtgcgtcaacctgagcgaccgggatttccggggcaaggtgcgcgagaaacgg
gtcggcaacttcctcctgttcgtggtggatgccagcggctccatgggcgccagggggcgc
atggccgcatccaagggggcggtgatgtcgctgcttctggacgcctatcagaagcgcgac
cgggtggggatgatctccttcaggaagaacgaggcgttcgtcaacctgccccccacgacc
tcggtggagctggccggcaagctgctggaggagatgccggtgggggggcgcaccccgctg
tcggcggctatcgccaagagctatgaacagctgcgcggcgtgctgggcagggatccgacg
gcgcggccgatcgtcatcttcatcaccgacggcaagagcaacgtggccctgggggacggc
aggccggtggacgaagccatgggactggcccgggccatggcagtgaaggaggagcgggcg
cgctacatcgtggttgatacggaggaagagggcatggtctccttcgggctggcccgcagg
ctggccgatgccatggaggccgagtacttcaggatcgatcagctgaaggcccagagcctg
gtgaatatcgtcaagcagcggatggactga

DBGET integrated database retrieval system