KEGG   Pelobacter propionicus: Ppro_1293Help
Entry
Ppro_1293         CDS       T00436                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppd  Pelobacter propionicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ppro_1293
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ppro_1293
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ppro_1293
Enzymes [BR:ppd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ppro_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1362172..1363527)
Genome map
AA seq 451 aa AA seqDB search
MNTKILLNEDQIPRQWYNIIPDMPGPLAPVINPQTLKPIVPEDMLSIFPMSLIEQEMSPQ
RWIDIPDEVRDIYRLWRPSPLFRAHRLEKALGTPAKIYYKHEGVSPAGSHKPNSAIPQAW
YNKQAGIRRLATETGAGQWGTSLALACSMFGLECTIYMVKVSCSQKPYRKSMMQLWGATV
IPSPSELTNAGRSILAHDPDCSGSLGIAISEAVEDAANHADTNYALGSVLNHVCLHQTVI
GQEAREQMKIAGDYPDVVIACCGGGSNFAGLAFPFIADRASGKQVRCLAVEPASCPTLTK
GVYAFDYGDTARMAPIAMMYTLGHDFVPPGIHAGGLRYHGQSPLISQLYHAGQIEAKSYK
QNACFEGALLFSRCEGIVPAPESSHAVRAAIDEAVLAKEEGKERTILFGLSGHGQLDMGA
YDAYLSGDLEDYEYSSELVKQSLERLPKVQL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacaaaaattctactcaacgaagatcagattccccgccagtggtacaacatcatc
cccgatatgccaggcccgctggcgccggtcatcaacccccagacattgaagcctatcgtt
ccggaggacatgctgtcgatcttccccatgtccttgatcgaacaggagatgtccccccag
cgctggatcgacatcccggacgaggtgcgtgacatatacagactctggcggccgtcaccg
ctgttccgtgcccaccgcctggaaaaggcgctggggacaccggccaagatctactacaag
cacgagggggtctcgccggccggttcccacaagcccaactcggcaatcccccaggcctgg
tacaacaagcaggccggcatccgccgcctggccacggagaccggggccggacagtggggc
acgtcactggccctggcctgctccatgttcggcctggagtgcaccatctacatggtcaag
gtatcctgcagccagaaaccgtaccgcaagagcatgatgcagctgtggggggcaacggtg
atcccctccccttccgaattaaccaatgccgggcgctcgatcctggcccacgatccggac
tgcagcggcagcctgggcatcgccatctccgaggcggtggaggatgcggccaaccatgcc
gacaccaactacgccctgggtagcgtgctcaaccatgtctgcctgcaccagaccgtgatc
ggccaggaggccagggagcagatgaagattgccggtgactacccggacgtggtcatcgcc
tgctgcggcggcggctccaattttgccggcctggccttccccttcatcgccgaccgggcc
agtggcaagcaggtgcgctgtcttgcggttgagccggcgtcctgcccgaccctcaccaag
ggggtctatgcctttgactacggcgacaccgccaggatggcgcccatcgccatgatgtat
actctgggccatgacttcgtcccccccggcattcatgccggcggtctgcgttaccacggt
cagtcccctctgatctcccagctctaccacgccggccagatcgaggccaagtcttacaag
cagaatgcctgcttcgagggggcactgctcttctcccgctgcgaggggatcgtgcctgcg
cccgagtcgtcccatgcggtgcgcgctgccatcgacgaggcggtgctggccaaggaagag
ggcaaggagcgcaccatcctgttcggcctgtccgggcacggccagctggacatgggcgcc
tacgacgcctacctctccggcgacctggaagattacgagtattcaagcgagctggtgaaa
cagtcactggagcgtctgcccaaagtacagctgtaa

DBGET integrated database retrieval system