KEGG   Pelobacter propionicus: Ppro_1293Help
Entry
Ppro_1293         CDS       T00436                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00260  Glycine, serine and threonine metabolism
ppd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01130  Biosynthesis of antibiotics
ppd01230  Biosynthesis of amino acids
Module
ppd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ppro_1293
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ppro_1293
Enzymes [BR:ppd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ppro_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABK98913
UniProt: A1ANJ3
Position
complement(1362172..1363527)
Genome map
AA seq 451 aa AA seqDB search
MNTKILLNEDQIPRQWYNIIPDMPGPLAPVINPQTLKPIVPEDMLSIFPMSLIEQEMSPQ
RWIDIPDEVRDIYRLWRPSPLFRAHRLEKALGTPAKIYYKHEGVSPAGSHKPNSAIPQAW
YNKQAGIRRLATETGAGQWGTSLALACSMFGLECTIYMVKVSCSQKPYRKSMMQLWGATV
IPSPSELTNAGRSILAHDPDCSGSLGIAISEAVEDAANHADTNYALGSVLNHVCLHQTVI
GQEAREQMKIAGDYPDVVIACCGGGSNFAGLAFPFIADRASGKQVRCLAVEPASCPTLTK
GVYAFDYGDTARMAPIAMMYTLGHDFVPPGIHAGGLRYHGQSPLISQLYHAGQIEAKSYK
QNACFEGALLFSRCEGIVPAPESSHAVRAAIDEAVLAKEEGKERTILFGLSGHGQLDMGA
YDAYLSGDLEDYEYSSELVKQSLERLPKVQL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacaaaaattctactcaacgaagatcagattccccgccagtggtacaacatcatc
cccgatatgccaggcccgctggcgccggtcatcaacccccagacattgaagcctatcgtt
ccggaggacatgctgtcgatcttccccatgtccttgatcgaacaggagatgtccccccag
cgctggatcgacatcccggacgaggtgcgtgacatatacagactctggcggccgtcaccg
ctgttccgtgcccaccgcctggaaaaggcgctggggacaccggccaagatctactacaag
cacgagggggtctcgccggccggttcccacaagcccaactcggcaatcccccaggcctgg
tacaacaagcaggccggcatccgccgcctggccacggagaccggggccggacagtggggc
acgtcactggccctggcctgctccatgttcggcctggagtgcaccatctacatggtcaag
gtatcctgcagccagaaaccgtaccgcaagagcatgatgcagctgtggggggcaacggtg
atcccctccccttccgaattaaccaatgccgggcgctcgatcctggcccacgatccggac
tgcagcggcagcctgggcatcgccatctccgaggcggtggaggatgcggccaaccatgcc
gacaccaactacgccctgggtagcgtgctcaaccatgtctgcctgcaccagaccgtgatc
ggccaggaggccagggagcagatgaagattgccggtgactacccggacgtggtcatcgcc
tgctgcggcggcggctccaattttgccggcctggccttccccttcatcgccgaccgggcc
agtggcaagcaggtgcgctgtcttgcggttgagccggcgtcctgcccgaccctcaccaag
ggggtctatgcctttgactacggcgacaccgccaggatggcgcccatcgccatgatgtat
actctgggccatgacttcgtcccccccggcattcatgccggcggtctgcgttaccacggt
cagtcccctctgatctcccagctctaccacgccggccagatcgaggccaagtcttacaag
cagaatgcctgcttcgagggggcactgctcttctcccgctgcgaggggatcgtgcctgcg
cccgagtcgtcccatgcggtgcgcgctgccatcgacgaggcggtgctggccaaggaagag
ggcaaggagcgcaccatcctgttcggcctgtccgggcacggccagctggacatgggcgcc
tacgacgcctacctctccggcgacctggaagattacgagtattcaagcgagctggtgaaa
cagtcactggagcgtctgcccaaagtacagctgtaa

DBGET integrated database retrieval system