KEGG   Pelobacter propionicus: Ppro_1385Help
Entry
Ppro_1385         CDS       T00436                                 

Definition
(GenBank) peptidase M42 family protein
Organism
ppd  Pelobacter propionicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1476338..1477411
Genome map
AA seq 357 aa AA seqDB search
MRKESLKFLEKLLDAPSPSGYEQPAQRVFREYVAPFCDELTTDVMGNVFARVAGQGENLP
RVMVVGHTDEIGLQVKYIDDKGFLYFAAVGGVDAHLTPGKRVNVHTAGGPLPGVIGKKPI
HLMDTKDRETVVKLESQYIDIGASDKEEAQKLVRVGDAVTFASSFTRLHGDRVASRGFDD
KAGCFVVAEVLRLVKASGRKLNLDLYGVSSVQEEIGLRGGTTSSYSVNPDVGICVEVDFA
TDQPDVEKKHNGEVGLGKGPILARGANINPRLFELLCETAESEKLVIQHTASPRATGTDA
NVMQISRGGVATALVKIPLRYMHTPIETVALSDLENAAKLIVATLDRITSRDEFVPK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaggaatcactgaaatttctggaaaaactcctcgatgcccccagtccctccggc
tatgagcagcctgcccagcgggtctttcgcgagtatgtggcccctttctgcgacgaactg
accaccgatgtcatgggcaacgtgttcgcccgcgtggcgggccagggagagaacctgccg
cgggtgatggtggtgggccacaccgacgagatcggcctgcaggtcaagtacatcgacgac
aagggcttcctctatttcgcggcggtcgggggggtggatgcccacctgacgcctggcaaa
cgggtcaatgtgcacacggcaggaggccccctgccaggcgtgatcggcaagaagccgatc
cacctgatggacaccaaggaccgcgagaccgtggtcaagctggagtcccagtacatcgat
atcggcgccagcgacaaggaagaggcccagaagctggtcagggtgggggatgcggtaacc
tttgccagttcgttcacccgtctgcacggtgaccgggtggcctcgcgcggtttcgacgac
aaggccggctgcttcgtggtggccgaggtgctgcgcctggtgaaggcatcaggcaggaag
ctgaatctggacctgtacggcgtctcgtcggttcaggaggagattggcctgcgcggcggg
accaccagcagctacagcgtgaaccccgatgtgggcatctgcgtggaggtggattttgcc
accgaccagcctgacgtggagaagaagcacaacggcgaggtggggctgggtaaggggccg
atcctggcccgcggcgccaacatcaacccgcgcctgttcgaactgctctgcgagaccgcc
gagagcgagaagctcgtcatccagcacaccgccagcccccgggccaccggcaccgatgcc
aacgtgatgcagatctcccgtggcggcgttgccaccgccctggtgaaaataccgctgcgc
tacatgcacacccccatcgagaccgtggcgctcagcgacctggaaaacgcggccaagctg
atcgtggcaactctggatcggataacctcgcgggatgagttcgtgccgaaataa

DBGET integrated database retrieval system