KEGG   Pelobacter propionicus: Ppro_1611Help
Entry
Ppro_1611         CDS       T00436                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppd  Pelobacter propionicus
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ppro_1611
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Ppro_1611
Enzymes [BR:ppd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ppro_1611
Two-component system [BR:ppd02022]
 CheA family
  CheA-CheYBV
   Ppro_1611
Bacterial motility proteins [BR:ppd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ppro_1611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1726164..1727234
Genome map
AA seq 356 aa AA seqDB search
MEKIKVLVIDDSVLVRQTLCEILNSDPGILVIATAADPILAAERLRTVVPDVITLDVEMP
RMDGLTFLQKLMSQHPIPVVMCSSLAESGSETALKALEYGAVDIITKPKLGTKQFIEESR
VRICDAIKGAAAARLEPMRAMRTMKEISPKYTADVIMEKPNTKAMIQTTEKVVVVGASTG
GTEALKVFLEMLPEDTPGIVIVQHMPENFTAAFAKRLDATCRVTVKEARDNDTIVRGRAL
IAPGNHHALLKRSGARYYVEIKDGPLVSRHRPSVDVLFRSAARYAGRNAVGVIMTGMGDD
GARGMREMYDAGAITIAQDEATCVVYGMPCEAVKQGGVHKITPLQHIAAEVLRLCC
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaatcaaggtactggtgatcgatgattcggtgttggtgcgtcagacattgtgc
gaaattctcaattccgatcccggaatcctggtgattgccacggccgccgatcccatactg
gcggcggagcgtctgagaacggtcgttcccgatgtgatcacgctggatgtggagatgccg
cgcatggatggtttgacgttcctgcagaaactgatgagccagcaccccattccggtggtg
atgtgttccagtctggcggagagcggcagtgaaacagcgctcaaggccctggaatacggt
gcggtggatatcattaccaaaccaaagctgggaaccaagcagtttatcgaggagtcacgg
gtccgtatctgcgatgccatcaagggggctgccgcggccaggctggaaccgatgcgggcg
atgcgaaccatgaaagagatatcgcccaaatacaccgcagatgtgatcatggaaaagccc
aataccaaggccatgatccagaccaccgaaaaggttgtggtggtgggcgcctcaaccggc
ggcaccgaggcgctcaaggtctttctggagatgctccccgaggatacccccggcatcgtc
atcgttcaacacatgccggagaacttcaccgccgcattcgccaagcgtctggatgccacc
tgccgggtgacggtcaaggaggcacgggacaacgatacgattgtgcgaggcagggcgctg
atcgcgccgggcaaccatcacgcacttctcaagcgcagtggcgcgcgctattacgtggag
attaaggatggtccactggtatcccgacaccgcccctcggtggatgtgctcttccgttcc
gcggctcgctatgccggaagaaacgcggtcggtgtgatcatgaccggcatgggggacgac
ggagcgcggggcatgcgggagatgtacgacgccggagccatcaccatcgcccaggatgag
gcgacctgcgtggtttacggcatgccgtgcgaggcggtaaagcagggaggtgtccacaag
ataacgccgcttcaacatattgcagccgaggtgctgcgactctgctgctaa

DBGET integrated database retrieval system