KEGG   Pelobacter propionicus: Ppro_1644Help
Entry
Ppro_1644         CDS       T00436                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppd  Pelobacter propionicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppro_1644
   01230 Biosynthesis of amino acids
    Ppro_1644
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_1644
   00030 Pentose phosphate pathway
    Ppro_1644
   00051 Fructose and mannose metabolism
    Ppro_1644
   00052 Galactose metabolism
    Ppro_1644
  Energy metabolism
   00680 Methane metabolism
    Ppro_1644
Enzymes [BR:ppd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ppro_1644
Protein phosphatases and associated proteins [BR:ppd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ppro_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1763563..1764852)
Genome map
AA seq 429 aa AA seqDB search
MNHQEPDFNVERLGECRFPSPMRGVRFTTDGERILYHSRYQEMRPFIDSGREPPSMEMGG
PRERIFFDPSTIACGIVTCGGLCPGTNDVIRALTLSLYHHYGVRRVYGFRYGFEGVVKRH
GHSPLLLTPEVVDRIGELGGTILASSRGPQAPSEMVDYLEELGIAILFTIGGDGTLKGAA
KIAEEAARRGRPISVIGIPKTIDNDVSFLQNTFGFETAVDEAHRAIYAAHTEATGARNGI
GLVKLMGRDSGFIAAYSTLVNSQVNFCLVPEVPFTLAGFLKSLEERLALRGHAVIAVAEG
AGQELLPAATESDASGNVKLGDIGTFLRDAINGHFRAIGTEITLKYIDPSYIIRSQPANS
HDSAFCLLLGHNAVHAGMCGRTCMVVGNWNQQFTHVPIRLATHQRKKIDPKGRLWSSVLA
STGQSREID
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaggaaccggatttcaacgtggaacgtctgggcgagtgccgcttcccctct
cccatgcggggggtacgcttcaccaccgacggagaacgtatcctctaccactcccgctac
caggaaatgcgtcccttcatcgacagcggcagggagcccccttccatggagatgggcggt
ccgcgggaacggatcttcttcgacccgtccaccatcgcctgcggcatcgtcacctgcggc
ggcctctgccccggaaccaacgacgtgatccgcgccctgaccttgagcctctaccaccac
tacggcgtgcggcgggtctacggtttccgctacggcttcgagggtgtggtgaagcgccac
ggccactcccccctgctgctcacccccgaggtggtggaccgtatcggtgagctggggggg
acgatcctggcttcctcccgcggcccccaggcgccgtctgaaatggtcgactacctggaa
gaactgggcatagccatcctcttcaccatcggcggcgacggaaccctcaaaggggctgcc
aagatcgccgaagaggcggcccggcggggcaggcccatcagcgtgatcggcatacccaag
accatcgacaacgacgtatccttcctgcaaaacaccttcggtttcgaaaccgccgtggac
gaggcccaccgggccatctacgccgcccacaccgaagccaccggggcacgcaacggcatt
ggcctggtgaagctgatgggacgggactccggcttcattgccgcctactccaccctggtc
aacagccaggtcaacttctgccttgttcccgaggttcccttcaccctggccgggttcctg
aagagcctggaggaacgtctggccctgcgcggccatgcggtgattgccgttgccgaggga
gcgggccaggagctgctgccggccgccacggagagtgacgcatcgggtaacgtcaaactg
ggcgacatcggcacctttctgcgggacgccatcaacggacacttccgcgccatcggcacg
gagatcaccctcaagtacatcgacccaagctacatcatccgcagccagccggccaactcc
cacgattcggctttctgcctgctgctgggacacaacgccgttcatgccggcatgtgcggc
aggacctgcatggttgtggggaactggaaccagcagttcacccatgtccccatcaggctc
gcaacccaccagaggaagaagatcgaccccaaggggcgactctggagcagcgtcctggca
tccaccggccagtcccgcgagatagactga

DBGET integrated database retrieval system