KEGG   Pelobacter propionicus: Ppro_1644Help
Entry
Ppro_1644         CDS       T00436                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppd  Pelobacter propionicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ppd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppd00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ppd00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ppd00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppd00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1763563..1764852)
Genome map
AA seq 429 aa AA seqDB search
MNHQEPDFNVERLGECRFPSPMRGVRFTTDGERILYHSRYQEMRPFIDSGREPPSMEMGG
PRERIFFDPSTIACGIVTCGGLCPGTNDVIRALTLSLYHHYGVRRVYGFRYGFEGVVKRH
GHSPLLLTPEVVDRIGELGGTILASSRGPQAPSEMVDYLEELGIAILFTIGGDGTLKGAA
KIAEEAARRGRPISVIGIPKTIDNDVSFLQNTFGFETAVDEAHRAIYAAHTEATGARNGI
GLVKLMGRDSGFIAAYSTLVNSQVNFCLVPEVPFTLAGFLKSLEERLALRGHAVIAVAEG
AGQELLPAATESDASGNVKLGDIGTFLRDAINGHFRAIGTEITLKYIDPSYIIRSQPANS
HDSAFCLLLGHNAVHAGMCGRTCMVVGNWNQQFTHVPIRLATHQRKKIDPKGRLWSSVLA
STGQSREID
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaggaaccggatttcaacgtggaacgtctgggcgagtgccgcttcccctct
cccatgcggggggtacgcttcaccaccgacggagaacgtatcctctaccactcccgctac
caggaaatgcgtcccttcatcgacagcggcagggagcccccttccatggagatgggcggt
ccgcgggaacggatcttcttcgacccgtccaccatcgcctgcggcatcgtcacctgcggc
ggcctctgccccggaaccaacgacgtgatccgcgccctgaccttgagcctctaccaccac
tacggcgtgcggcgggtctacggtttccgctacggcttcgagggtgtggtgaagcgccac
ggccactcccccctgctgctcacccccgaggtggtggaccgtatcggtgagctggggggg
acgatcctggcttcctcccgcggcccccaggcgccgtctgaaatggtcgactacctggaa
gaactgggcatagccatcctcttcaccatcggcggcgacggaaccctcaaaggggctgcc
aagatcgccgaagaggcggcccggcggggcaggcccatcagcgtgatcggcatacccaag
accatcgacaacgacgtatccttcctgcaaaacaccttcggtttcgaaaccgccgtggac
gaggcccaccgggccatctacgccgcccacaccgaagccaccggggcacgcaacggcatt
ggcctggtgaagctgatgggacgggactccggcttcattgccgcctactccaccctggtc
aacagccaggtcaacttctgccttgttcccgaggttcccttcaccctggccgggttcctg
aagagcctggaggaacgtctggccctgcgcggccatgcggtgattgccgttgccgaggga
gcgggccaggagctgctgccggccgccacggagagtgacgcatcgggtaacgtcaaactg
ggcgacatcggcacctttctgcgggacgccatcaacggacacttccgcgccatcggcacg
gagatcaccctcaagtacatcgacccaagctacatcatccgcagccagccggccaactcc
cacgattcggctttctgcctgctgctgggacacaacgccgttcatgccggcatgtgcggc
aggacctgcatggttgtggggaactggaaccagcagttcacccatgtccccatcaggctc
gcaacccaccagaggaagaagatcgaccccaaggggcgactctggagcagcgtcctggca
tccaccggccagtcccgcgagatagactga

DBGET integrated database retrieval system