KEGG   Pelobacter propionicus: Ppro_1695Help
Entry
Ppro_1695         CDS       T00436                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppd  Pelobacter propionicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppro_1695 (tpiA)
   01230 Biosynthesis of amino acids
    Ppro_1695 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_1695 (tpiA)
   00051 Fructose and mannose metabolism
    Ppro_1695 (tpiA)
   00562 Inositol phosphate metabolism
    Ppro_1695 (tpiA)
Enzymes [BR:ppd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ppro_1695 (tpiA)
Exosome [BR:ppd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ppro_1695 (tpiA)
  Exosomal proteins of bladder cancer cells
   Ppro_1695 (tpiA)
  Exosomal proteins of melanoma cells
   Ppro_1695 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1822115..1822870
Genome map
AA seq 251 aa AA seqDB search
MRTPLIAGNWKLHKTIAESLAMVDELKPLVAGSRGVEIVVAPVFTALKSVSFALNGSDIG
LAAQDCFWEEQGAFTGEVSPAQLRDAGCSHVIIGHSERRQLFGETDEGVNRKARAAVAVG
LTAIICVGETMEERESRATFTVVGRQVTAALAGFLSHEFSRIVIAYEPVWAIGTGKTATD
QQAQEVHCYIRNLVTMSISQAIADSLRILYGGSVKPDNIRGLMAQPDIDGALIGGASLKA
ASFAEMVNFRG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgccgctgatcgcaggaaactggaaactgcacaagaccattgccgagtcgttg
gccatggtggatgaactgaaaccgctggtggcgggaagcaggggggtggagatcgtcgtt
gctccggtgttcaccgccctgaaaagcgtttcgttcgctctgaacggtagtgacatcggg
cttgccgcccaggactgcttctgggaagaacagggggccttcaccggggaggtgtcgccg
gcgcagctcagggatgcggggtgcagtcatgtgatcatcgggcattccgagcgccgccag
ctcttcggcgagaccgatgagggggtgaatcgcaaggccagggcggccgtggccgtcggc
ctgaccgccatcatctgcgtaggggaaaccatggaggagcgggagagtcgcgccaccttc
accgtggtgggcaggcaggttacggccgccctggccggcttcttgtcccacgaattttcc
cgcatcgtcatcgcctacgaaccggtctgggccatcggaaccggcaagaccgccacggac
cagcaggcccaggaggttcactgctatatccgtaacctggtcaccatgtccatcagccag
gcgattgccgattccctgcgtatcctctacggtggcagcgtcaaaccggacaacatcagg
ggactcatggcgcaaccggacatagatggagccctgatcggcggcgccagcctgaaggcc
gcctcctttgccgagatggtgaatttccggggatga

DBGET integrated database retrieval system