KEGG   Pelobacter propionicus: Ppro_1738Help
Entry
Ppro_1738         CDS       T00436                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppd  Pelobacter propionicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ppro_1738
Enzymes [BR:ppd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Ppro_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1871688..1873181
Genome map
AA seq 497 aa AA seqDB search
MLTARTCGVLLHPTSLPGRGGIGSLGEDARCFVDLLADMGMSLWQVLPLTPPACGNSPYS
AFSAFAGNPLLIDCDQLVAEGDLAEYSPPDVPSTERVDFGSVIESKLALLRRAASAFFAA
GVTGRMEEFWRFCDTNTWLHDYALFMAIKEQRNGASWHRWPAAMARHTPAMYEKLSVQLG
PEIGVQKYMQWQFFRQWRSLRDYAASRGIRLVGDMPLFVAYDSADVWSRRSLFLLDEKGR
PLCMAGVPPDYFSATGQLWGNPLYDWQALEGHGFDWWIERFRHLFTLYDAVRIDHFRGFE
AAWHVPAGERTAKRGAWVEGPGRAFFDAVGASLGKLPIIAEDLGEITPAVEELRDRYGFP
GMKILQFAFDSGPANPYLPHNHTRSCVVYTGTHDNCTTRGWYDGLSLEQRREVRHYIGCA
SEKIVEGMLRMALMSVADTVILPFQDLLGLPADARMNVPGTAEGNWGWRFSWDMVPRRLG
ADLAEMVKRYGRSMGKF
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggccagaacctgcggagtactgcttcatccgacgtcgttgccgggaaggggg
ggcatcggatccctgggggaagatgctcgctgtttcgtcgacctgctggcggacatgggc
atgtcgctctggcaggtgctgccgctgacccctccagcctgtggcaactctccctactcg
gccttttccgcctttgccggtaacccgctgctgatcgattgcgatcaactggtggcggag
ggggacctggcggagtactccccccctgacgtcccatccacggagcgggtggatttcggc
tcggtcatcgagtccaagctggctctcctgcgccgggcagccagcgccttcttcgccgcg
ggcgtaaccgggcggatggaagaattctggcgcttctgcgataccaacacctggctgcat
gactacgctctcttcatggccatcaaggagcagcggaacggtgccagctggcatcgctgg
ccagccgccatggcgcggcacacgccggcaatgtacgagaagctctccgtgcaactgggg
ccggagatcggcgtccagaagtacatgcagtggcagtttttccgccagtggcgttcgctg
cgcgactacgccgccagccgggggatcaggctggtgggcgacatgccgcttttcgtggcc
tacgattccgccgatgtctggagcaggcgttccctcttcttgcttgatgaaaaaggccgc
cctctgtgtatggcaggggtaccgcccgactatttcagcgcaacgggccagttgtggggc
aatccgctctatgactggcaggcgcttgaggggcatgggttcgattggtggatcgagcgc
ttccgccacctgttcaccctctacgatgccgtgcgcatcgaccatttccgcggcttcgag
gctgcctggcatgttcccgccggcgagcggaccgccaaacggggcgcctgggtggaaggg
ccggggagggctttcttcgacgccgtcggcgcgtctctggggaaactgcctatcattgcc
gaagacctgggagagatcaccccggctgtggaggaactgcgcgaccgctacggctttccc
ggcatgaagattctccagttcgccttcgactccggcccggccaatccctatctgccgcac
aaccacaccaggagctgcgtggtgtacaccggtacccacgacaactgcaccaccaggggg
tggtacgacggcctctctctcgaacagcgccgggaggtgcggcactacatcggctgcgcg
tcggaaaaaattgtggaaggaatgctcaggatggcgctgatgtccgtggctgacacggtt
attcttccctttcaggacctgctcggcctgcccgccgatgcgcgcatgaacgttcccgga
acagccgaaggtaactggggatggcgtttttcctgggatatggttccacggcgcctgggg
gccgacctggccgagatggtgaaacggtatgggcgcagtatgggcaagttctga

DBGET integrated database retrieval system