KEGG   Pelobacter propionicus: Ppro_1864Help
Entry
Ppro_1864         CDS       T00436                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppd  Pelobacter propionicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ppro_1864
Enzymes [BR:ppd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ppro_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2006218..2008404)
Genome map
AA seq 728 aa AA seqDB search
MKQPNSLDTPVERLSGSVERVTFHSEESGFCVLRTKVKGQRELITVIGSAASITPGEYIE
CIGIWTNDRTHGLQFKANQLKVVPPSTLEGIEKYLGSGMVKGIGPHFAKILVKAFKEDVF
TVIESEPEKLLTLPGIGRKRMEKVTSAWSEQKVIREIMVFLQSHGIGTGRAVRIYKTYGD
ESILKVTENPYRLALDIHGIGFKTADTLAMKLGIAADSLIRAQAGVRHVLQEIADDGHCA
APWVDLVKSAAELLEIPASIIEEAIHAEIAEENLIQEDIEGSACLFLIPLFRAESGTATS
ITRLLRGTPPWGVIDAEKAIPWVEAKTGLTLSSSQRDAVILALNSKVVVITGGPGVGKTT
LVNSILLTIQAKQMRVTLCAPTGRAAKRLSESTGIEAKTIHRLLEFDPQSFGFKRNKDNP
LETDLVVIDESSMVDIALMNKLLAAVPTNAALMIVGDVDQLPSVGPGSVLSDIIDSGVVP
TVRLTEIFRQAANSRIIVNAHRINKGEMPLKAEGTELSDFYFIPTNTPEEIHDKLIQVVT
ERIPKRFGLHPVKDIQVLTPTNRGGLGAHSLNAELQKALNEKAEPKVTRFGTTFAPDDKV
IQTVNNYDKEVFNGDIGQITEIDVEEGLLQVDYDGRTVEYEFGELDEVSLAYATSIHKSQ
GSEYPAVVIPLAMQHYTLLERNLIYTAVTRGKKLVTIIGQPKALAMAVKNRKSNKRLTKL
ASRISESG
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcccaattcgcttgatacccctgtcgaacgcctctccggttcagttgaacgg
gtcaccttccacagtgaagaatccggcttctgtgtgctccgtaccaaagtcaagggacag
cgggaactgattaccgttatcggttccgctgcatccatcacccccggtgaatacattgag
tgcattggtatctggacaaacgaccgaacccacggactacaattcaaagccaaccagttg
aaagtcgtaccaccaagcacacttgaaggaattgagaaatatctcggctcagggatggtc
aagggaattggtcctcacttcgccaagattctcgtcaaagctttcaaagaggatgtcttc
accgtaatcgaatctgaaccagagaagctgcttactcttcccggtatcggtcgaaagcgc
atggagaaggtgacaagtgcctggtccgaacagaaagtcattcgtgaaatcatggtcttc
cttcaatcgcacggaatcggaacaggacgagcggtcaggatatacaagacctatggcgac
gaatccattctcaaggtaactgaaaacccttacagactcgcactggatattcacggtatt
ggtttcaagaccgcagacactcttgccatgaagctggggatcgctgctgattcacttatt
cgcgctcaagccggtgtccgtcatgttcttcaggaaattgcagatgatggacattgtgct
gcgccatgggttgacttggttaaatctgcagccgaacttttggaaataccagcaagcatt
atagaagaggccattcatgctgaaattgcagaagagaaccttatccaggaggatattgaa
ggctcagcctgtctcttcctgatccctctgtttcgtgctgaatccggaaccgctacaagc
atcacccggctcctacggggaacacctccctggggagtaattgatgcagaaaaggctatt
ccctgggtagaagcaaagaccggcctgacactatccagttcccaacgtgatgccgtcatt
ttagctctcaacagcaaagtcgtggttattaccggtggtcctggtgttggcaaaacgacc
ctggtcaacagcatactgctcacgatccaggcaaagcagatgagggttactctctgtgca
ccgaccggacgtgctgccaaaagattgtcggaatcaaccggtattgaggcaaagaccatc
caccgcttgctggagttcgacccgcagtcattcggattcaagcgaaataaagataatccg
ctggaaaccgacctggtggttatagacgaatcttcaatggttgatatagccttgatgaat
aagcttctggctgccgttccaaccaatgcagctctgatgattgttggagacgttgaccaa
ctcccctctgtcggtcccggctccgtgctttcggatatcattgattcgggagtagtgcct
actgtgaggcttacggagatattccgtcaagcagcaaattcacgcatcatcgtcaatgcc
caccgaatcaataagggtgagatgcctctcaaagccgaaggcaccgaactatcggacttt
tatttcattccgaccaatactccggaagaaatccatgacaaactcattcaggttgtcaca
gagcgtatccccaagagatttggtcttcatccggtgaaagatatccaggtgcttacccca
acgaatcgtggcggtcttggtgcgcattcattgaatgccgagttgcagaaggcgctaaac
gaaaaggcggaaccaaaagtcacacgattcggcaccacctttgctcccgacgacaaggtc
atccagacggtgaacaactacgataaagaggtgttcaacggtgacatcggtcagattact
gagattgatgtcgaagaaggattattacaggttgattatgatggcagaactgttgaatac
gagttcggcgaactggatgaggtttctctggcctatgccaccagcatccataaaagccag
ggatcggaatacccagcggtggtgattcctttggccatgcagcattacacgctgttggag
cgcaatctgatatacactgccgtcaccaggggaaagaagctcgtgacgatcatcggtcaa
ccaaaggcgctagcaatggcggtcaagaaccggaagtcgaataagcgactgactaagctg
gcttctagaatatcagaatccgggtaa

DBGET integrated database retrieval system