KEGG   Pelobacter propionicus: Ppro_1924Help
Entry
Ppro_1924         CDS       T00436                                 

Definition
aldehyde dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ppd  Pelobacter propionicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ppro_1924
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppro_1924
  Lipid metabolism
   00071 Fatty acid degradation
    Ppro_1924
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ppro_1924
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ppro_1924
   00626 Naphthalene degradation
    Ppro_1924
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ppro_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2072715..2074052)
Genome map
AA seq 445 aa AA seqDB search
MAVAEKINEMVQKAKAAVAEYKKLNQEQTDAICEAIAKVIDAKKEELAQDAVTETRLGKV
ADKTIKNYFGSTVIWNDMKGVKTVGVIKDENNIIEIAEPVGVIAGVCPTTNPTSTVAFKV
LSALKCRNAIIFGFHPRAQKCCEKTAQLCLDAAIKAGAPKDCIQWITEPSVEATNALMTN
PGVDVILATGGGAMVRAAYSSGNPAFGVGAGGCPVYVAADADIDQAMSDTVLSKNFDHGV
VCASEQNLIFDNPQTAEKAIAKLKELKTYVCNDDEKKKLEALYFDHYVVNGAVVGLHAAK
IAEMAGFSVPADTEVLLVGPLKGLQDVEPMCREKLSPTLGYYIVDGKDAAIDLCEKLLQG
GGAGHTAGIHSSNEATCLQFAQTVDANRVTFNSPTSHGAIGGLYNVLIPSLTLGCGSRGK
NITSDNVSFRNLVNIKRAARRVVQG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtagctgagaaaattaatgaaatggtgcagaaagccaaagcagccgtcgcagag
tacaagaagctcaaccaggagcagaccgatgctatctgcgaagccatcgccaaggtaatc
gacgcgaaaaaagaagaacttgcacaggatgccgtaacggaaacccgcctcggtaaggta
gctgacaagaccatcaagaactatttcggctccacggttatctggaacgacatgaaaggt
gtcaagaccgtcggcgtcatcaaggacgaaaacaatatcatcgagatcgccgagccggtt
ggtgttattgctggcgtatgtccgaccaccaacccgacctccaccgttgccttcaaggtc
ctctccgccctcaaatgccgcaacgcgatcatcttcggcttccacccccgcgcccagaag
tgctgtgaaaaaaccgcccagctctgcctggacgccgccatcaaagccggcgctccgaaa
gattgcatccagtggatcaccgagccttccgtcgaggctaccaacgccctgatgaccaac
cccggcgttgatgtcatcctggcaaccggcggcggcgccatggttagggctgcctacagc
tccggcaaccccgctttcggcgtgggcgcaggcggatgccccgtgtatgtcgctgcagat
gccgacatcgaccaggccatgtccgacaccgttctctccaagaacttcgaccacggcgtt
gtctgcgcttccgagcagaacctgatcttcgacaacccccagaccgccgagaaggccatt
gccaagctgaaagagctcaaaacatacgtctgcaacgacgatgagaagaagaaactggaa
gctctgtacttcgaccactatgtcgtcaacggcgccgttgttggtctgcacgctgccaag
atcgctgaaatggccggcttctccgtacccgccgacaccgaagtactgctggttggtccg
ctgaaaggcctgcaggacgtagagcccatgtgccgtgaaaaactctccccgaccctgggt
tactacatcgtggacggcaaagacgctgctatcgatctttgtgaaaaactgctgcagggt
ggtggcgctggtcacaccgctggtatccactcctctaacgaagcaacctgcctccagttt
gcacagactgttgacgccaaccgcgttaccttcaactccccgaccagccacggcgccatc
ggcggcctgtacaatgttctgattccctccctgaccctcggttgcggctccaggggcaag
aacatcaccagcgacaacgtcagcttccgtaacctggttaacatcaagcgcgctgcacgt
cgtgttgtccagggctaa

DBGET integrated database retrieval system