KEGG   Pelobacter propionicus: Ppro_2084Help
Entry
Ppro_2084         CDS       T00436                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ppd  Pelobacter propionicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ppro_2084
Enzymes [BR:ppd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ppro_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2241667..2243520
Genome map
AA seq 617 aa AA seqDB search
MKFSQFIGQEDAGLGLLLNAVDPRCGGLLLVGGRGSGKSTLARLARGIIPAHLPFVELPL
NVTEESLLGGIDLEQTLASGRPVLQPGIISRANGGVVFVDDINLLSRELLALLMEPQSRG
MEIIQREGLTEQRESSFVILATMNPEEGDLSPHLADRIGLCAVMEEQNGRDERLAIMRLA
KETPFFTVEHDREAMDLISVARGLLPEVRFSAQALEHLQQVVQRNISPGHRGDLFLYHAA
RACAALQGAADVEKEHIDRVANLVFSHRRLQLREEEQNSTEPEQPHDQDQQQNNEQRDDQ
GEQPPPPENGQDENDRHPSGEGEHESTVSMGESAQREEIMGVGAPFKLRRLSFRKDRRKR
QANGRRTRTRIKGRGGRYVKSLLSSTEHDIAIDATLRACAPFQKARNRQGMLKIEQDDLR
FRQRERRMGHLVLFVVDGSGSMGARQRMMETKGAVQSLLLDCYQKRDKVAMIVFRKDRAE
LVLPPTASVELAARRLAELPVGGKTPLASGLLKTHRLVRRTSMHHPEQRILVVLITDGRG
NQHLTPETRKEEVSNLAGLLMEEPQCDFIVIDTEHKGNFLRSDLAMDLARQLEAEYYTIE
ALKSEYLAGMVQARMPG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattcagccagttcatcggccaggaggatgccgggctggggctgctgctgaacgcc
gtcgatccgcgctgcggcgggcttttgctggtgggaggcagggggagcggcaaatccacc
ctggcccgcctggcacggggcatcatcccggcccacctccccttcgtcgagctgccgctg
aatgtcaccgaagagtcgcttttggggggcatcgacctggaacagaccctggccagcggc
cgacctgtcctacaaccgggcatcatctcgcgggcgaatggtggcgttgtctttgtggac
gacatcaacctgctctcccgggaactgctggcgctcttgatggaaccccagtcacggggt
atggagatcatccagcgggagggtctgaccgaacagagagagagcagctttgtcatcctg
gccaccatgaaccctgaagagggagacctgtcgccgcacctggccgaccgcatcggcctc
tgcgccgtcatggaggagcagaacggccgcgatgagcgtctggccatcatgcgcctggcc
aaagagactcccttttttaccgtcgagcatgaccgggaagccatggaccttatcagtgtc
gcccggggtctgctgccggaggtcaggttttcagcccaggccctggagcatcttcaacag
gtcgtgcaacggaacatcagccccggccaccggggcgacctgtttctctaccatgcggcc
cgagcctgtgccgcattgcagggcgcagccgatgtggaaaaggagcacatcgaccgggtc
gccaacctggtcttcagccaccgtcgcctgcaactccgtgaagaggagcagaactccacc
gagccggagcagccgcacgaccaggaccagcagcagaacaacgaacagcgcgacgaccag
ggcgaacagccgcctccaccggagaacggacaggatgaaaacgaccggcacccctccggt
gagggagagcatgagtccaccgtctcaatgggcgaatctgcccagcgggaagagatcatg
ggggtgggggctcctttcaagctgcgccgcctcagttttcgcaaggatcgccgaaaacgc
caggccaacggccgtcgcaccaggacccgcatcaaggggcgcggcgggcgctacgtcaag
agcctgctcagctcgaccgagcacgacatcgccatcgacgccaccctgcgtgcctgcgcc
ccctttcagaaggcgcgcaatcgccaggggatgctgaagatcgagcaggacgacctgcgt
ttccgtcagcgggagcgcaggatggggcacctggtgctgttcgtggtggatggatccggt
tccatgggggctcggcagcggatgatggaaaccaagggcgcagtccagtcgctgctcttg
gactgttaccagaaacgggacaaggtggccatgatcgtctttcgcaaggaccgggccgaa
ctggtgctgccccccacggccagcgtggagttggctgccaggcgtctggcagagttgccg
gtggggggcaagacccccctggcgtccggcctgctgaaaacccaccgcctggtcaggcgc
acctctatgcaccaccccgaacagcgcatcctggtggtactgatcaccgatgggagaggc
aaccagcacctgacgccggaaactaggaaggaagaggtatccaacctggccggcctgctg
atggaggagccccagtgcgacttcatcgtcatcgataccgagcataagggcaatttcctg
cgaagcgatctggcaatggacctggcccgccaactggaggcggagtactacaccatcgag
gcgcttaagtccgagtacctggccgggatggtccaggccaggatgcccggctaa

DBGET integrated database retrieval system