KEGG   Pelobacter propionicus: Ppro_2150Help
Entry
Ppro_2150         CDS       T00436                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppd  Pelobacter propionicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ppro_2150
Enzymes [BR:ppd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ppro_2150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2311875..2313689
Genome map
AA seq 604 aa AA seqDB search
MATVFELTATDIHFAEFIQREAGETPAWFRPMAALVSNAMGNGNICLDLSDIAEKIIQVD
GRDQQFPALSEMRDLLAGMPVIGSPGDFRPLVLDGDCRLYLYRYWKYERELVRVIQDKSS
LPGCDIDETLLGAGIGRLFPPSSGEGVDWQKVAALGALWKRFFVISGGPGTGKTSTVVKI
LALLLEQAQGATVHIALAAPTGKSAARLKESIRLMKESLDCSPEVKSRIPEEVTTIHRLL
GVRSGSVRFQYSAENQLPYGVVIVDEASMVALPLMAKLATALKPEARIILLGDKDQLASV
EAGAALGDICGGGRPELFSTAFQSFVARVAGGRLPSTAVATCTGFPGDALAVLKRNYRFA
TESGIGGTARAVNSGDAGSALRLLNDELHQDIRWQEAPSTEQLKKALAERIVSGYSSYLA
AATAEEALRLFDGFRVLTALRQGPYGVAGVNGLIEEILAEQGLIERQTLWYPGRPVMITV
NDYHLKLFNGDIGIVFPDPEANGNPKVFFPSPEGGVRTVSPLRLPAHDTVYAMTIHKSQG
SEFNRILLLLPEQDSELLTRELIYTGLTRAKKEVEIWGDEGVFRTAVSRRVERTSGLRKA
LWGD
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggttttcgaactcactgctacggacatccactttgccgaattcatccagcgc
gaggcgggagagactccagcctggttcagacccatggctgcgctggtgagcaatgccatg
ggcaacggcaacatctgccttgatctgtcggatatcgcggaaaagatcatccaggtggat
ggcagggatcaacagttcccggcactctctgaaatgcgtgacctactggctggcatgccg
gtgataggctcccccggtgattttcggccactggtgcttgacggtgattgccggctctac
ctctaccgctactggaagtatgagcgggaactggtgcgggtcatccaggacaagtcttcc
ctccccgggtgcgacatcgatgagacgctccttggcgcggggatcggcaggcttttcccc
ccctcttccggagagggggtcgactggcaaaaggttgccgctctgggggcactctggaag
cggttcttcgtcatttccggcgggccgggaacgggcaagacctccacggtggtcaagatc
cttgcactgctcctggagcaggcgcaaggggcaaccgttcacattgccctggctgctccg
acgggtaaatcggcggcgcgactcaaggaatcgatccgcctgatgaaggaaagcctggat
tgcagcccggaggtgaagagccggattccggaagaggtcacaaccatccaccgtctgctt
ggggtccgttccggatcggtccgttttcaatactccgctgaaaatcagctgccctacggc
gttgtcatcgttgacgaggcatccatggttgcgctcccccttatggcaaagctggccacg
gcactcaagccggaggcgcgcatcatcctgctgggggacaaggaccagttggcctcggtc
gaggcaggggcggcgctgggggacatctgcggcggagggcggcccgagcttttttccaca
gcttttcagtcctttgtcgccagggtcgccggcgggcgactcccctcgacagctgtggcc
acctgcaccggctttcccggcgatgccctggccgttctgaaaaggaattaccgctttgcg
accgaaagcggcattggggggacggcgagagcggttaactcgggagatgcgggaagcgcc
ctgcggctgctcaacgatgagctgcatcaggatatccgctggcaggaggcgccttcgacc
gaacagctgaagaaagcgctcgcggagagaatcgtctccgggtattcatcctacctcgcg
gccgctaccgccgaagaggcactgcggctgttcgacggtttcagggtgctgacggccctg
cgtcaggggccgtacggcgttgccggggtcaacgggctgatcgaggagattctcgccgaa
caggggctgatcgagcgtcaaaccctttggtatcccgggcgtccggtgatgatcacggtg
aatgattaccatctgaaactgttcaatggagacatcgggatcgtttttcccgacccggag
gcaaatgggaatcccaaggtcttcttcccctctccggaagggggggtgcgcacagtttct
cccttacgcctccccgcgcacgacaccgtttacgccatgaccattcacaagagccagggc
tcggagttcaaccggatccttttgctgctcccggagcaggactcggaacttttgaccagg
gaattgatctataccggacttacccgggcaaaaaaagaggttgagatctggggagacgag
ggggttttcaggaccgccgtatcacggagggtcgagcgcacctccggtctcaggaaagcg
ctctggggcgattga

  All links  
No link information was found.   
DBGET integrated database retrieval system