KEGG   Pelobacter propionicus: Ppro_2357Help
Entry
Ppro_2357         CDS       T00436                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppd  Pelobacter propionicus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppd00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ppd00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2548674..2549855
Genome map
AA seq 393 aa AA seqDB search
MHCNSFSRQHRFSLHVAMTALTLLLLGLLAGCAATSSAVTSKLPDWRSWTVERKIAQMLL
LGFPGETITPESPISVAIREHGVGGVVLFDNNADLGVTERNISNPAQLKRLITDLKASAE
TPIFIAVDEEGGIISRLKERYGFPSTVSASYLGEKNDLNLTRSSSDRLVDTLVEYGFNLN
LAPVVDLSINPANPVIALKQRSFSADPALVSAHAAEVIASHHRKNIVTCLKHFPGHGSSR
DDSHVGFVDVTDSWSEKELLPYKNLIGQGVVDSVMTAHTFNTHLDPDYPATLSRNTIDGI
LRTRLGFDGVVISDDLYMAAIVQHYSYETAVEKAINAGVDLLILANDKLYSPDIAPRTID
LVVKMVESGKISRERIDQACGRIMKLKARYLFE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcactgcaactcgttttccaggcagcaccgtttttcgctccatgtggcaatgactgcg
ttgaccctgctgcttctgggtttgctggccggatgtgccgcaacgtcaagcgccgtcacg
agcaaactacccgactggcgttcctggacagtggagcgcaaaattgcccagatgcttctg
ctcggtttccctggagagacgattactccggaaagccctatttctgtggctatccgcgag
catggcgtgggcggggtcgtccttttcgacaacaatgccgacctgggtgttacggagcgc
aatatttccaacccggctcagctaaagaggctgatcaccgaccttaaggcatcggctgaa
acgccgattttcattgccgtggatgaagagggagggatcatctcccgcctcaaggagcgc
tacgggtttccgtccacggtctccgcttcataccttggggagaagaatgacttaaacctc
acccgttcttcctcggaccgactggtcgacaccctggtggaatacggcttcaacctgaac
ctggcgccggtggtcgacctgagcatcaaccccgcaaacccggtcattgcgctgaaacag
cgcagcttttccgccgacccggccctggtttccgcccacgcggcagaagtcatcgcgagc
caccaccgcaagaatatcgtcacctgcctgaagcactttccagggcacggcagctcgcgc
gacgattcccatgtggggttcgtcgatgtcaccgacagctggagcgagaaagaactgttg
ccctacaaaaacctgatcgggcaaggggtggtggatagtgtgatgacagcccacaccttc
aacacacatctcgacccggactatccggcaacgctctccaggaacaccatagacggcata
ctgcgcacgcggctcggcttcgacggagtggtcatcagcgatgacctctacatggcagcg
attgttcagcattacagctatgagaccgctgtggaaaaagccatcaacgccggggtcgac
ctgctgatcctggccaacgacaagctctacagcccggacatagctccgcgcaccatcgat
cttgtggtgaagatggtggagagcgggaaaatcagcagggagcgcatcgaccaggcctgc
ggccggatcatgaaactgaaggcgagatacctctttgaataa

DBGET integrated database retrieval system