KEGG   Pelobacter propionicus: Ppro_2357Help
Entry
Ppro_2357         CDS       T00436                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppd  Pelobacter propionicus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ppro_2357
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Ppro_2357
Enzymes [BR:ppd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ppro_2357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2548674..2549855
Genome map
AA seq 393 aa AA seqDB search
MHCNSFSRQHRFSLHVAMTALTLLLLGLLAGCAATSSAVTSKLPDWRSWTVERKIAQMLL
LGFPGETITPESPISVAIREHGVGGVVLFDNNADLGVTERNISNPAQLKRLITDLKASAE
TPIFIAVDEEGGIISRLKERYGFPSTVSASYLGEKNDLNLTRSSSDRLVDTLVEYGFNLN
LAPVVDLSINPANPVIALKQRSFSADPALVSAHAAEVIASHHRKNIVTCLKHFPGHGSSR
DDSHVGFVDVTDSWSEKELLPYKNLIGQGVVDSVMTAHTFNTHLDPDYPATLSRNTIDGI
LRTRLGFDGVVISDDLYMAAIVQHYSYETAVEKAINAGVDLLILANDKLYSPDIAPRTID
LVVKMVESGKISRERIDQACGRIMKLKARYLFE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcactgcaactcgttttccaggcagcaccgtttttcgctccatgtggcaatgactgcg
ttgaccctgctgcttctgggtttgctggccggatgtgccgcaacgtcaagcgccgtcacg
agcaaactacccgactggcgttcctggacagtggagcgcaaaattgcccagatgcttctg
ctcggtttccctggagagacgattactccggaaagccctatttctgtggctatccgcgag
catggcgtgggcggggtcgtccttttcgacaacaatgccgacctgggtgttacggagcgc
aatatttccaacccggctcagctaaagaggctgatcaccgaccttaaggcatcggctgaa
acgccgattttcattgccgtggatgaagagggagggatcatctcccgcctcaaggagcgc
tacgggtttccgtccacggtctccgcttcataccttggggagaagaatgacttaaacctc
acccgttcttcctcggaccgactggtcgacaccctggtggaatacggcttcaacctgaac
ctggcgccggtggtcgacctgagcatcaaccccgcaaacccggtcattgcgctgaaacag
cgcagcttttccgccgacccggccctggtttccgcccacgcggcagaagtcatcgcgagc
caccaccgcaagaatatcgtcacctgcctgaagcactttccagggcacggcagctcgcgc
gacgattcccatgtggggttcgtcgatgtcaccgacagctggagcgagaaagaactgttg
ccctacaaaaacctgatcgggcaaggggtggtggatagtgtgatgacagcccacaccttc
aacacacatctcgacccggactatccggcaacgctctccaggaacaccatagacggcata
ctgcgcacgcggctcggcttcgacggagtggtcatcagcgatgacctctacatggcagcg
attgttcagcattacagctatgagaccgctgtggaaaaagccatcaacgccggggtcgac
ctgctgatcctggccaacgacaagctctacagcccggacatagctccgcgcaccatcgat
cttgtggtgaagatggtggagagcgggaaaatcagcagggagcgcatcgaccaggcctgc
ggccggatcatgaaactgaaggcgagatacctctttgaataa

DBGET integrated database retrieval system