KEGG   Pelobacter propionicus: Ppro_2738Help
Entry
Ppro_2738         CDS       T00436                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ppd  Pelobacter propionicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2997413..2998060
Genome map
AA seq 215 aa AA seqDB search
MNFDRARKKMVQEQIATRGITDRRVLDAMLKTPRHIFVQEAMAAQAYSDSSLPVGEKQTI
SQPYTVALMTELLELTGREKVLEIGTGSGYQTAILAALADRVYTVERIRPLALRARKCLD
SLRLFNVMLRINDSEGSPIGWDEEAPFDAIIVTAGAPAVPQVLTDQLAVDGRLVIPVGDE
REQRLVKIVRKNDGTLETTTSIGCRFVPLIGRQGW
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgatagagcacgtaaaaagatggttcaggaacagatcgcgacccgcggaatc
accgaccgccgggtgctggacgccatgctgaaaacaccgcgccacatcttcgtccaggag
gccatggcggcccaggcctacagcgactcttcactgccggtgggggagaagcagaccata
tcccagccttataccgtggcactgatgaccgaactgctggagttgaccggcagggaaaag
gtgctggagatcggcaccggttccggctaccagacggctatcctggccgccctggccgat
cgcgtctataccgtggagcggatccgccccctggccctgcgcgccagaaagtgcctggac
tccctgcgcctgttcaacgtcatgctgcgcatcaacgacagcgaggggagccccatcggc
tgggatgaggaggcccccttcgacgccatcatcgtcaccgccggggctccggcggttccc
caggtactcacggaccagttggccgttgacggccgcctggttattccggtgggagacgaa
cgggaacaacgtttggtgaaaattgtcaggaagaacgacggaacactggaaacgacgaca
tccatcggctgccgcttcgtgccgctgatcggcagacaggggtggtag

DBGET integrated database retrieval system