KEGG   Pelobacter propionicus: Ppro_3042Help
Entry
Ppro_3042         CDS       T00436                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppd  Pelobacter propionicus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppd01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ppd00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3323587..3324879)
Genome map
AA seq 430 aa AA seqDB search
MKLMDMRDTDFGERFAVILSRGEEIDRAVEGSVAEIIADVRSRGDQALLDLTRRFDRLET
SSVAELEVGETEIDAALAAVAADDLASLRHAVERVTRFHEKQRQQTWLSTEEPDIMLGQK
VTPLERVGIYVPGGKASYPSSVIMNAVPARVAGVREILMVTPTPGGEVNPHVLAAARLSG
VDRIFRIGGAQAVAALAYGTATIPRVDKITGPGNIYVATAKKLVFGQVGIDMIAGPSEIL
VINDGSGDTAHVASDLLSQAEHDELASSILITTDRSFGERVAGEVERQLGLLSRESIARA
SWESYGAIIVAGSLDEAVAFSNRIAPEHLELAVADPFSLLPAITNAGAIFMGHWTPEAAG
DYLAGPNHTLPTGGTARFFSPLSVDDFVKKSSIVCLSEGGLKRLGRDIVRIAGLEGLEAH
ARSVSIRLDR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgatggacatgcgcgacaccgactttggagagcgcttcgccgtgatcctctcc
cgtggcgaggagatcgaccgcgccgttgaggggagcgtggcggagatcatcgccgatgtg
cgctcgcggggggaccaggcgctgctggacctgacccgtcgtttcgaccgcctcgagact
tcctccgtggctgaactggaggtcggggagacggagatcgacgccgcccttgcggccgtg
gctgctgacgacctggccagcctgcgacatgcagtggagcgggtaacccgctttcacgag
aagcagcgccagcagacctggctctccaccgaagagccggatatcatgctggggcagaag
gtgacccctctggagcgggtcggtatctatgtgccgggaggcaaggccagctaccccagc
agcgtgatcatgaacgccgttcccgcccgtgttgccggcgtccgtgaaatcctcatggtg
acgccgacaccgggcggagaggtcaacccccacgtgctggccgcggcgcgcctctccggt
gtggatcgcatcttccgcatcggcggggcccaggccgtggcggcactggcctacggcacc
gcaaccatcccccgggtggacaagatcaccggccccggtaacatctacgtagcaacggcc
aagaagctggtgttcgggcaggtgggcatcgacatgatagctggtcccagcgagatcctg
gtgatcaacgacggcagcggcgataccgcccacgtggcctccgacctgctctcccaagcc
gagcacgacgaactggcctcgtcgatcctgatcaccaccgaccgttcctttggcgaaagg
gtggcgggcgaggtcgagcgccagctggggctcctctcccgggagagcatcgcccgggct
tcctgggagagttacggcgccatcatcgtggctggttcgctggacgaagcggtggctttt
tccaaccgcatcgcgcccgagcacctggaactggctgttgccgatcccttcagcctgctg
ccggccatcaccaacgcgggtgccatcttcatggggcactggactcccgaggccgccggc
gactatctggcaggcccgaaccacaccctccccaccgggggtacggctcgcttcttctca
ccgctctcggtggatgatttcgtcaagaagtcgtccatcgtctgcctctctgaaggggga
ctgaagcgcctggggcgcgacatcgtcaggattgccggactggaggggctggaggcgcat
gccaggtcggtctccatacggctcgatagatag

DBGET integrated database retrieval system