KEGG   Pelobacter propionicus: Ppro_3264Help
Entry
Ppro_3264         CDS       T00436                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppd  Pelobacter propionicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ppro_3264
Enzymes [BR:ppd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Ppro_3264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3587678..3589186)
Genome map
AA seq 502 aa AA seqDB search
MLNRRGCGVLLHPTSLPGPGGIGSLGVHGRRFVDLLCDMGMSYWQVLPLTPPACGNSPYS
AFSAFAGNPLLIDLERVAEEGDLGSADQGEGYPEGYVDFGAVILRKTELLRRAGEAFLAR
GDAGRTAEFREFCANTPWLEDYALFMALKHRFQGKVWNHWPEGLARITPRARRQQGEWLR
HDMQLQSYLQWQCARQWQELRRYANRRGIAIIGDIPIFVAYDSADVWGERGLFLLDREGD
PTVVAGVPPDYFSATGQLWGNPLYDWEAMERDGYEWWIRRFRASLELFDIVRVDHFRGFE
AAWQVPAGATTARGGRWVKGPGELLFDRLRDVLGELPVIAEDLGVITPEVLTLRDRYRFP
GMKILQFAFDADLDDRDLPHNHVPHGVVFTGTHDNDTTRGWCESRSAAELEEMAAYLGTA
GDDCPGDLMRAALMSVANTAILPLQDILGLDSGARMNIPGTPWGNWEWRFTWEMIPEGLA
ASLRSRLERYGRGRHGGNDHGT
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacagacgagggtgcggggtcctgctgcatccgacctccctgcccggccccggc
gggatcggctcgctgggggtgcatggccggcgtttcgtggaccttttgtgcgacatgggc
atgtcctactggcaggttctgccgctcaccccccctgcctgcggcaattccccctattcc
gcctttagcgcctttgccggcaacccgctgctgatcgacctggaacgggtggcggaggag
ggggatctgggctccgccgaccagggggaggggtatcccgaggggtatgtggattttggc
gccgttatcctgcgcaagacggaactgctgcggcgggcgggggaggccttcctggcccgg
ggggacgcgggtcgcacggcggaattccgggagttttgcgccaatactccctggctggag
gattatgccctcttcatggcgctcaagcaccgctttcagggcaaggtatggaatcactgg
cccgaggggctcgcccgcatcaccccccgggcgcgccgccagcagggggaatggctccgc
cacgacatgcagcttcagagctatctgcagtggcagtgtgcgcggcagtggcaggaactg
cgccgttacgccaacaggcggggaatagccatcattggcgacatccccatcttcgtggcc
tacgattcggccgatgtgtggggcgagcgcgggctgttcctgctggaccgagagggcgat
ccgacggtggtggccggtgttccccccgactacttcagcgccaccggacagttgtggggc
aatccgctctacgactgggaggccatggagcgggacggatacgagtggtggatccggcgc
ttccgggccagcctggagctcttcgacatcgtccgggtggaccacttccgcggattcgag
gctgcctggcaggtgccggccggcgccaccacggcccgtgggggacgctgggtcaaaggg
ccgggggagttgttgttcgaccgcctgcgggacgtgctgggggagcttccggtcattgcc
gaagatttgggggtgatcacgccggaggtgctgacgctcagggaccgctaccgcttccct
ggcatgaagatcctgcagttcgccttcgacgccgacctggacgaccgggacctgccccac
aaccacgtcccccatggcgtggtgtttaccggcacgcatgacaacgacaccaccagaggg
tggtgcgaatcccgctcggccgcggagctggaggagatggccgcctacctgggcacggcc
ggggacgactgccccggcgacctgatgcgcgccgcgctcatgtccgtggccaacaccgcc
atcctgccgctgcaggatatcctcggtctggacagcggggcacgtatgaacattcccggc
accccctggggcaactgggagtggcgcttcacctgggagatgattccggaggggctggcg
gcctcgctgcgcagccggctggaacgctacggcaggggacggcatggaggaaacgatcat
gggacatga

DBGET integrated database retrieval system