KEGG   Pelobacter propionicus: Ppro_3347Help
Entry
Ppro_3347         CDS       T00436                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00521  Streptomycin biosynthesis
ppd00523  Polyketide sugar unit biosynthesis
ppd01130  Biosynthesis of antibiotics
Module
ppd_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Ppro_3347
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ppro_3347
Enzymes [BR:ppd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Ppro_3347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2 Cupin_1 Cupin_4
Motif
Other DBs
NCBI-ProteinID: ABL00940
UniProt: A1AUB9
Position
complement(3694999..3695562)
Genome map
AA seq 187 aa AA seqDB search
MTFIHTRISGCLEIVPVCFQDERGRFVKTYNEKTFESHGCCTDWKEEFYSVSRRGVLRGL
HFQLPPHQHDKLVYCTAGTVLDAVVDLRKGSPTYGDHIMLELSAEKGNMLYIPRGLAHGF
YVTSESATMMYKVSSVYAPDHDAGIRWDSAGIAWPASTPIISTKDGLLPPLIDFSSPFSF
DDCAKRQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacttttatacatacaagaatttcaggttgcctcgagatcgttcctgtttgtttccag
gacgaacgtggcaggttcgtcaaaacctacaacgaaaaaacgttcgagtcgcacggctgt
tgcaccgactggaaagaagaattctactcagtttccaggcggggagtgcttcgagggttg
cacttccaactccccccccatcagcacgacaagttggtatactgcaccgcgggcacggta
ctggatgcggtcgtggacctacgaaaaggctctcccacatatggggatcatattatgctc
gaactgagtgccgaaaaaggaaacatgctctacatcccccgggggctcgcccatgggttt
tacgtcaccagcgagtcagccacaatgatgtacaaggtttcttctgtctacgctcctgac
catgatgccggaatccgctgggactctgccggaattgcctggcccgccagcacgccgatc
atatccacaaaggatggcctcctcccgcctcttattgacttttcatctcctttttccttt
gacgattgtgcgaaaagacaatga

DBGET integrated database retrieval system