KEGG   Pelobacter propionicus: Ppro_3804Help
Entry
Ppro_3804         CDS       T00436                                 

Definition
ATPase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppd  Pelobacter propionicus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pPRO1:180873..182933
Genome map
AA seq 686 aa AA seqDB search
MFFFLTRVVKVGEKPAQSMIDMFSDAELTSIMETPARHNELLNVKGIGGSRLGKIIGSWQ
KYRHIKMLSDFLSPYGLSPGLITRVYNHFEDRAIVIIKGNPYSLTHVNGIGFKKADDVAL
RLGTDPHDPFRLAACLQFVMASMADDSGNTLVKPEDVISQAAKELDSENGSNIERIELAG
ELEQMEGREEIVRLGDMLALKRHHATEKRICEALRRRVELPPVPIKSPSETQRFIESIEQ
KIGITFSEEQVDSIKMVAAGHRTIAVTGYAGTGKSTVSKALIQLLLSKFDEDQVCCMALS
GIASDRIRTLSGFNSFTIHSALGWRGQEFEHGPDNQLGYQVIVLDEGSMVNSFIMRNLIE
AVDRDAVLILMGDPGQLPPIGAGDPFRNIIESGIIPVARLTRIYRQSDDSVLSFFANDIR
RGVVPTGYLQEEGFKDFQFVQKNLPGNYFRLSDKDKVPLREENSQRIIEFIEAKMRAISP
YIKNPILDFQLLSPIRKGPLGTEALNDVAQRVFNPGEHEGRAVQVGSVTFKPGDKVVHTL
NRDMQIVKAHSLSDYHNNIDSSETKRVFNGSVGVILDGDSDNRELLVAYPEGFIAKYDSL
LLSAGVLEMAYALTTHKCQGSEYRFVLIPISSAHTIMLTAQWLYTAVTRAKQKVLMVGQK
YMFERACKSLTETRRTTVLEKLISLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgttcttttttctgactcgggtagttaaagttggtgaaaagccagcgcagtccatgatt
gacatgttttcggatgctgagttgacatcaattatggaaacgcctgccagacataacgaa
ctcctgaatgtgaagggtattggtggatctcgcctgggcaaaatcatcggttcatggcag
aaataccgtcacatcaagatgctatccgattttctttcgccttatggactctcccctggc
cttatcactcgtgtgtataaccactttgaagaccgtgccatagtgattatcaaggggaat
ccgtactcacttacccatgtgaacggaatcggttttaaaaaagcagatgatgttgcgtta
cgactcggcaccgatccgcatgacccttttcgcctggcagcctgtctgcaattcgtgatg
gcatcaatggccgatgacagtgggaacactctggtcaaacccgaagacgttattagtcag
gccgcaaaggaactggatagcgaaaacggcagcaacattgagagaatagaacttgccggc
gaactcgaacagatggaggggagagaagagatcgttcgcttgggtgacatgcttgctctg
aaacggcaccatgccacggaaaagcgaatatgcgaggctctacggcgcagggttgagttg
ccaccagtacccatcaaatccccttccgaaacccagcggttcatagaatcaatagaacaa
aaaataggcatcaccttttccgaagagcaggttgattcgatcaaaatggttgcggccggt
catcgcactattgctgtcactgggtacgccggaaccggcaagagcacagtatcaaaagcc
ttgattcaactactactgtccaagttcgacgaagatcaggtctgctgcatggcgctttcc
ggtattgcctcagacagaatcagaaccctctccggattcaactctttcacgatacattcg
gcattaggttggaggggacaagagtttgaacatggcccggataaccagcttggttaccag
gtaatcgtcttggatgaaggcagtatggtgaactcgtttatcatgaggaatttgattgag
gcggttgaccgggatgctgtcctgattctgatgggagatcctgggcagcttccccccatt
ggcgccggcgatccgtttcgcaacatcatcgagagcggcattattcctgtggctcgattg
acccgaatttaccgtcaatcagatgattccgtgctttcgtttttcgctaacgatatccgc
agaggagtggtgccaacaggttatctccaggaagaaggattcaaggattttcagtttgtc
caaaagaatctaccagggaattacttccggttatccgacaaggacaaggttccgttgcgc
gaagaaaatagccagcggatcattgaattcattgaagcaaaaatgcgtgcgatttcgcct
tacattaaaaacccaatccttgattttcagcttctgtcgccgataaggaaaggtccgcta
gggacagaggcgcttaatgatgttgcccagcgcgtgttcaatccaggagagcatgagggg
agagccgtgcaagtcggcagtgtaacattcaaacctggcgacaaggttgtccatacactg
aaccgtgatatgcaaatagtaaaggctcacagcttgagcgactatcacaacaacatcgat
tcatcggaaaccaaaagagttttcaacggatcagttggtgttattcttgacggagattcc
gataatcgcgagctgctcgttgcataccccgaaggatttattgcaaaatatgactcgttg
ctgttgagcgcaggggttttagaaatggcctatgctcttaccactcacaagtgtcaaggc
agcgaataccgctttgtcctgatcccaatctcgtcagcacacacgatcatgcttaccgca
cagtggctctacactgctgtcacgcgagcaaaacagaaggtgctgatggtgggtcaaaaa
tatatgttcgaaagggcttgcaagagcctaaccgagacaaggagaacaacggttttggaa
aaactgatttccttagcataa

DBGET integrated database retrieval system