KEGG   Pelobacter propionicus: Ppro_3804Help
Entry
Ppro_3804         CDS       T00436                                 

Definition
(GenBank) ATPase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppd  Pelobacter propionicus
Pathway
ppd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ppro_3804
Enzymes [BR:ppd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ppro_3804
DNA repair and recombination proteins [BR:ppd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Ppro_3804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 Viral_helicase1 PIF1 AAA_18 Mg_chelatase AAA_22 AAA_24 AAA_16 AAA_29 CoaE RNA_helicase T2SSE Sigma54_activat AAA_14 APS_kinase ArgK DUF87 FtsK_SpoIIIE ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABL01392
UniProt: A0R7T4
Position
pPRO1:180873..182933
Genome map
AA seq 686 aa AA seqDB search
MFFFLTRVVKVGEKPAQSMIDMFSDAELTSIMETPARHNELLNVKGIGGSRLGKIIGSWQ
KYRHIKMLSDFLSPYGLSPGLITRVYNHFEDRAIVIIKGNPYSLTHVNGIGFKKADDVAL
RLGTDPHDPFRLAACLQFVMASMADDSGNTLVKPEDVISQAAKELDSENGSNIERIELAG
ELEQMEGREEIVRLGDMLALKRHHATEKRICEALRRRVELPPVPIKSPSETQRFIESIEQ
KIGITFSEEQVDSIKMVAAGHRTIAVTGYAGTGKSTVSKALIQLLLSKFDEDQVCCMALS
GIASDRIRTLSGFNSFTIHSALGWRGQEFEHGPDNQLGYQVIVLDEGSMVNSFIMRNLIE
AVDRDAVLILMGDPGQLPPIGAGDPFRNIIESGIIPVARLTRIYRQSDDSVLSFFANDIR
RGVVPTGYLQEEGFKDFQFVQKNLPGNYFRLSDKDKVPLREENSQRIIEFIEAKMRAISP
YIKNPILDFQLLSPIRKGPLGTEALNDVAQRVFNPGEHEGRAVQVGSVTFKPGDKVVHTL
NRDMQIVKAHSLSDYHNNIDSSETKRVFNGSVGVILDGDSDNRELLVAYPEGFIAKYDSL
LLSAGVLEMAYALTTHKCQGSEYRFVLIPISSAHTIMLTAQWLYTAVTRAKQKVLMVGQK
YMFERACKSLTETRRTTVLEKLISLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgttcttttttctgactcgggtagttaaagttggtgaaaagccagcgcagtccatgatt
gacatgttttcggatgctgagttgacatcaattatggaaacgcctgccagacataacgaa
ctcctgaatgtgaagggtattggtggatctcgcctgggcaaaatcatcggttcatggcag
aaataccgtcacatcaagatgctatccgattttctttcgccttatggactctcccctggc
cttatcactcgtgtgtataaccactttgaagaccgtgccatagtgattatcaaggggaat
ccgtactcacttacccatgtgaacggaatcggttttaaaaaagcagatgatgttgcgtta
cgactcggcaccgatccgcatgacccttttcgcctggcagcctgtctgcaattcgtgatg
gcatcaatggccgatgacagtgggaacactctggtcaaacccgaagacgttattagtcag
gccgcaaaggaactggatagcgaaaacggcagcaacattgagagaatagaacttgccggc
gaactcgaacagatggaggggagagaagagatcgttcgcttgggtgacatgcttgctctg
aaacggcaccatgccacggaaaagcgaatatgcgaggctctacggcgcagggttgagttg
ccaccagtacccatcaaatccccttccgaaacccagcggttcatagaatcaatagaacaa
aaaataggcatcaccttttccgaagagcaggttgattcgatcaaaatggttgcggccggt
catcgcactattgctgtcactgggtacgccggaaccggcaagagcacagtatcaaaagcc
ttgattcaactactactgtccaagttcgacgaagatcaggtctgctgcatggcgctttcc
ggtattgcctcagacagaatcagaaccctctccggattcaactctttcacgatacattcg
gcattaggttggaggggacaagagtttgaacatggcccggataaccagcttggttaccag
gtaatcgtcttggatgaaggcagtatggtgaactcgtttatcatgaggaatttgattgag
gcggttgaccgggatgctgtcctgattctgatgggagatcctgggcagcttccccccatt
ggcgccggcgatccgtttcgcaacatcatcgagagcggcattattcctgtggctcgattg
acccgaatttaccgtcaatcagatgattccgtgctttcgtttttcgctaacgatatccgc
agaggagtggtgccaacaggttatctccaggaagaaggattcaaggattttcagtttgtc
caaaagaatctaccagggaattacttccggttatccgacaaggacaaggttccgttgcgc
gaagaaaatagccagcggatcattgaattcattgaagcaaaaatgcgtgcgatttcgcct
tacattaaaaacccaatccttgattttcagcttctgtcgccgataaggaaaggtccgcta
gggacagaggcgcttaatgatgttgcccagcgcgtgttcaatccaggagagcatgagggg
agagccgtgcaagtcggcagtgtaacattcaaacctggcgacaaggttgtccatacactg
aaccgtgatatgcaaatagtaaaggctcacagcttgagcgactatcacaacaacatcgat
tcatcggaaaccaaaagagttttcaacggatcagttggtgttattcttgacggagattcc
gataatcgcgagctgctcgttgcataccccgaaggatttattgcaaaatatgactcgttg
ctgttgagcgcaggggttttagaaatggcctatgctcttaccactcacaagtgtcaaggc
agcgaataccgctttgtcctgatcccaatctcgtcagcacacacgatcatgcttaccgca
cagtggctctacactgctgtcacgcgagcaaaacagaaggtgctgatggtgggtcaaaaa
tatatgttcgaaagggcttgcaagagcctaaccgagacaaggagaacaacggttttggaa
aaactgatttccttagcataa

DBGET integrated database retrieval system