KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0283Help
Entry
PEPE_0283         CDS       T00409                                 

Definition
Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppe00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
327507..328952
Genome map
AA seq 481 aa AA seqDB search
MTEKHYKMPENFLWGGAVAAHQFEGGWQEGGKGVSIADVMTAGNKDTARKVTDGIKDGEV
YPNHWGIDFYHRYPEDIKLFNEMGFKCFRTSIAWTRIFPNGDETEPNEAGLKFYDDMFDE
LLKYNIQPIITLSHFEMPYHLVKEYGGWTNRKLIDFFVRFAETVMKRYKGKVKYWMTFNE
INNQTDWSNPHHLLQDSAIKVKAGTPGMEEMMYQAAHNEMVASAKVVELGHQIDSEYQIG
AMIAMCPIYPLTAKPEDIMMAERAMQTRYYFGDVQANGEYPNWLPKYWERQNIHVEISDY
DREILKKGAVDYIGFSYYMSFTTKSTDENTDYAYKEARDLVDNPYVQKSDWGWQIDPVGL
RYSMNWMQDRWHKPQFIVENGFGAYDQKEADGAVHDDYRIKYFHDHILEMEKAVALDGVN
LIGYTPWGCIDLISASTGEMAKRYGFIYVDQDDQGNGSLERSKKDSFDWYKQVIASNGED
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaagcattataagatgccggaaaatttcttgtggggcggtgcagtagccgct
catcaatttgaaggcggatggcaagaaggcggtaagggagttagcattgcagacgtgatg
accgctggaaacaaagatactgctcgaaaagtaacggacggtattaaagatggagaagtt
tacccaaatcactgggggattgatttttatcatcgttatcctgaagatattaaacttttt
aacgaaatgggtttcaaatgcttccgtacctcgattgcatggactagaatttttcctaat
ggagatgaaaccgaacctaacgaagctggtttaaagttctatgatgatatgtttgatgaa
ctgttaaaatacaatattcaacccatcattactttgtcacacttcgaaatgccatatcat
ttagtaaaagaatatggtggttggactaatcgtaaattgattgactttttcgtacgtttt
gccgaaacagtgatgaaacgctataagggaaaagttaagtactggatgaccttcaacgag
attaataatcaaactgattggagtaatcctcatcatttacttcaagattcagccattaag
gttaaagctggaacaccaggaatggaagaaatgatgtatcaagccgctcataacgaaatg
gttgcaagtgctaaagtagttgaactaggccatcaaattgattcggaatatcaaattggt
gcaatgattgcaatgtgtccaatttatccactaactgctaagccagaagacatcatgatg
gctgaacgtgctatgcaaacgcgttactactttggagacgttcaagctaatggtgaatac
cctaattggcttcctaaatattgggaacgccaaaacatccatgtcgaaattagtgattat
gaccgagaaattttgaaaaagggtgcagttgattatattggatttagttactatatgtca
tttacaactaaatctacggatgaaaataccgactatgcctataaagaagcacgtgattta
gtcgacaatccttatgttcaaaaatcagattggggctggcagattgatcctgttggtcta
cgttattcgatgaattggatgcaagatcgttggcacaaacctcaatttattgtggaaaat
ggttttggagcatacgaccaaaaagaagccgatggtgctgtccatgatgattatcgcatc
aagtatttccacgatcatattttagagatggaaaaagcagttgccttagatggggtcaac
ttaattggttatactccatggggatgcatcgatttaatttcagcaagtactggagaaatg
gctaaacgttatggatttatctatgttgatcaagatgaccagggtaatggtagtctagaa
cgttcgaagaaggattcatttgattggtacaaacaagtaattgcatctaatggtgaagat
ttatag

DBGET integrated database retrieval system