KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0444Help
Entry
PEPE_0444         CDS       T00409                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PEPE_0444
   00052 Galactose metabolism
    PEPE_0444
   00500 Starch and sucrose metabolism
    PEPE_0444
   00520 Amino sugar and nucleotide sugar metabolism
    PEPE_0444
Enzymes [BR:ppe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PEPE_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
492937..493818
Genome map
AA seq 293 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPVTKASPKEMLPIVDKPTIQYIVEEARKSGIEDILIITGKG
KRAIEDHFDAVPELEENLKAKGKKEMLKMVEETTGLNMYFKRQSHPRGLGDAVLTAKSFV
GNEPFVVMLGDDLMEDKVPLTKQLVDSFEETGASTLAVLPVPHEEVSKYGVIDPSEEVEK
DLYNVSKFVEKPAVDEAPSNLAIIGRYVLTPEIFNILEKQGLGEGNEVQLTDAIDTLNKK
QRVFAKVFNGDRYDVGNKFGFLKTNIEYGLKHPETKDELKTYIKELAKELEEK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgtaaagcaattattcctgcagcaggattaggaactagatttttacca
gtaaccaaagcttcacctaaggaaatgttaccaattgttgataagccaacaattcaatac
attgtggaagaagctcgcaagtctggaatcgaagatatcctaattattacaggtaaaggt
aaacgtgctatcgaagatcactttgatgcggttcctgaactagaagaaaacttgaaagct
aagggcaagaaggaaatgttgaagatggtggaagaaaccactggcttaaatatgtacttc
aaacgtcaaagtcatccacgtggattaggggatgctgtattaactgctaaatcattcgtt
ggcaacgaaccattcgtggttatgcttggtgatgatttaatggaagacaaagttccgttg
actaagcaattggtagattcttttgaagaaactggtgcttcaactttagctgttttgcca
gttcctcatgaagaagtatctaagtatggggttatcgatccttctgaagaagttgaaaag
gatttatacaacgtttctaaattcgttgaaaaaccagccgtagatgaagcaccaagtaac
ttagcaattatcggacgttatgtacttacgccagaaattttcaatattttggaaaaacaa
ggccttggtgaaggtaatgaagttcaattaaccgatgccattgatacattaaataaaaaa
caacgcgtatttgccaaagtatttaatggcgaccgttacgatgtaggtaataagtttggc
ttcttgaagactaatattgaatatggtttaaaacatcctgaaacaaaagatgaattaaag
acctacatcaaagaattagccaaagaacttgaagaaaaataa

DBGET integrated database retrieval system