KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0513Help
Entry
PEPE_0513         CDS       T00409                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ppe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PEPE_0513
  Lipid metabolism
   00561 Glycerolipid metabolism
    PEPE_0513
   00600 Sphingolipid metabolism
    PEPE_0513
Enzymes [BR:ppe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PEPE_0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
564097..566298
Genome map
AA seq 733 aa AA seqDB search
MSLITVDQANRVFHLHNQNLSYIFAVEQGGTLSHLYFGGHVDHYHGELRYPRVDRGFSGN
LPGSTDRTFSRDTLPKEYSTAGEMDYHLPAAIVRHTDGANALFLVYQGYRIEAGKPKLSG
LPAAFVEDETEAETLTIVLVDQVSQVEFDLQYTIYRDRPVVTRSVQVCNQGDHAVNLEKV
ASMQIDFTDRQFETITLPGAHANERHPERGSINYGIQTFGSLRGTSSHQMNPFLALVDHT
TTEFSGDAYGFNLVYSGNHAFELEKDQLDQLHLMVGINSYNFNWQLKAGATFQTPEVLMV
YTNKGLNAMSQAYHHLIRERVVRSEFKNQERPIVVNNWEATFFDFNEAKLKPIVDEAKQL
GIEMFVLDDGWFGHRDDDNSSLGDWQVDHRKFPQGLNHFVKYVHEQGLKFGIWLEPEMIS
YDSKLYQQHPDYLMQVPGRSPSPSRNQYILDLGRQAVRNNIFDQLDQLLKSKQIDYIKWD
MNRHLSDIYSVALPPERQGEVYHRYVLGLYELLERLTTAYPHILFEGCSGGGGRFDAGMA
YYMPQIWASDNTDAVARLTIQYGTSLAYPISLATAHVSVSPNQQTGRETSMSTRSAVAAS
GVLGYELDLTQLSSADKQIVQKQVVQYKQIRPLIQFGEFYRLKSPITSNQAAWMFVSPQQ
DEAIVMVFNLTSYAQPSLTKTKLVGLNPKLNYQNIATKAIFGGDELMQLGFYDPVVYQDY
TTKVYHFKAVTEN
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaattacggttgatcaagcgaatcgcgtttttcatttgcataatcaaaatctt
tcttatatctttgcagttgagcagggcggtactttaagtcatttatattttggtgggcat
gtggaccattaccacggtgaattgcgctatccacgagtcgatcgtggtttttccggtaat
ttaccgggatcgactgatcgcactttttcacgtgatactttgccgaaagaatacagtacg
gctggtgaaatggattatcacttaccagcagcaatcgttcgtcatactgatggggctaat
gcattattcttagtttatcagggatatcggatcgaagcgggtaaaccaaagttaagcggg
ctaccggcagcttttgtggaggatgaaacagaggcagaaactttgaccatcgtattagtt
gatcaagtaagccaagtcgagtttgatctacaatatacgatctaccgtgatcgaccagtg
gtcacgcgctcggtgcaagtctgtaatcaaggtgatcatgcagttaatttagaaaaagtt
gcttcaatgcaaatcgattttacggatcgtcagttcgaaacaattacattacctggagcg
catgccaatgaacgccatccagagcggggttcgatcaattatggaatacagacttttggt
agtttgcggggtacttccagtcatcaaatgaatccatttttggccttggttgatcacact
acgacagagtttagcggtgatgcatatggttttaacttggtctattctggcaatcacgca
tttgaactggaaaaggatcaacttgaccaacttcatctaatggtcggtattaatagttat
aatttcaattggcaacttaaagctggcgcgactttccaaacaccagaagtattaatggtc
tatacaaataaaggtttgaacgcgatgagccaagcctaccaccatttgatccgtgaacga
gtagtacgtagtgagtttaaaaatcaagagcgtccgattgtagttaacaactgggaagca
acattctttgattttaacgaagcaaaattgaagccgatcgtggatgaagccaagcagtta
ggcattgaaatgtttgttttagatgatggttggtttggacatcgtgatgatgataattct
tcattaggtgactggcaagttgatcatagaaaatttccgcagggcttaaatcattttgtg
aaatatgtgcatgaacaaggccttaaatttggtatttggttagaaccagaaatgatttca
tatgattcaaagctatatcagcaacatccagattatttaatgcaagttcctggccgatca
ccaagtccatcacgtaatcagtatattttagatcttggtcggcaagccgtacgaaataat
atttttgaccagcttgatcaacttctaaaatcgaagcaaattgattatattaaatgggat
atgaatcgccacctttcagatatttattccgttgctttaccaccagaacgccagggtgag
gtctatcatcggtatgttttaggtctgtatgaattattggaacggttgacgacagcttat
ccgcatatcttatttgaaggttgctcaggtggtggcggtcgatttgatgctgggatggct
tactatatgccacagatttgggctagtgataacactgatgcagttgcgcgattgacgatt
caatatgggactagtttagcctatccaatttcgttagctaccgcccatgtctcagtgagc
cctaatcagcaaacaggtcgtgaaacgtcaatgtcgactagaagtgcagtagcggcaagc
ggtgtcttaggttatgaattggatctaacacaactcagttcagcggataaacaaatagtc
caaaagcaagttgtacagtataaacagattagaccactgattcaatttggtgaattttat
cgcttaaaatcaccaattactagcaatcaagcagcatggatgtttgtttcacctcaacaa
gatgaagcgattgtcatggtatttaatctgacatcctatgcccaacccagtttgacaaaa
accaaattagtcggtttgaatcccaagctgaattaccaaaatattgctactaaggcgata
tttggtggtgatgaattgatgcaacttggcttctatgatccagtagtctaccaagattac
acaacaaaggtctatcattttaaagcagtcactgagaactaa

DBGET integrated database retrieval system