KEGG   Pediococcus pentosaceus ATCC 25745: PEPE_0659Help
Entry
PEPE_0659         CDS       T00409                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ppe  Pediococcus pentosaceus ATCC 25745
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppe00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
697166..699046
Genome map
AA seq 626 aa AA seqDB search
MCGFAGYINQANVNKDTIKSMADRIKHRGPDDEAFFQDENASMGFRRLSIIDLAHGRQPM
MNSAETKVLTFNGEIYNYKQVREELKELGYEFRTDVDSEVLIHGYDAWGPELLKKLRGMF
AFVIYDKEKQEVFGARDHFGIKPLYYYDDDKTFLWGSEIKSFLEHPNFVKEFNEELLPIH
LSFEFIPSKETMFKNVYKLLPGTYFIHKNGKTETHTYFKFNYDHIDESQTIEEDSKKIRK
IVSDSVDAHMIADVEVGSFLSSGIDSSYVLAEAAKLKPIQSFSLGFRNSKYSELSYSTEF
AKEINQKNTPLYMDGDDYFDILPTIMYYMDEPLSNPSAMQLFYLSKGTRKNVKVALSGEG
ADEFFGGYNTYLEAFTFERYQKMVPSFIRKGLAKAVSGLPRFHGRRFLMRGAQPLSERYY
RVNYVFNQQERDQILRNPALNVDSGAYTQHIFDEVKGKDEMTQMQYFDINTWLPFDILHK
ADRMSMANSLEVRTPLVDREVAKFAATMPIKTRIHKEETKVSLRRAAEAELPERVAKKEK
LGFPSPIANWIKEDKYRKRIEAAFNSDIAKKFFKPEALMHILDEHVNGKSSMQKIFTIYT
FILWYGVFFPEDTNTNTIDLVKRTQV
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggatttgctggttacattaatcaagctaatgtaaataaagacacaatcaagtca
atggccgatcgaattaaacaccgaggaccagacgatgaagcatttttccaagatgaaaat
gcgtcaatgggattccgtcgcctatcaattattgatttggcacacggacgtcaacccatg
atgaatagtgctgaaactaaagtattaactttcaatggtgaaatttataactacaaacaa
gttcgtgaagaactaaaagaattaggatatgaatttagaacggatgttgattcagaagtc
ctaatccatggttatgacgcatggggaccagaattacttaaaaaacttcgtgggatgttt
gcctttgtaatttatgataaagaaaaacaagaagtatttggtgctcgtgatcattttgga
atcaagcctctttactactacgatgatgataaaacgttcctttggggttcagaaatcaaa
tcattcctagaacatccaaactttgtgaaggaattcaatgaagaactattaccaatccac
ttaagttttgaatttattccttctaaagaaacgatgtttaagaatgtttacaagcttctt
ccaggaacttacttcattcataaaaatggtaaaacagaaacccatacttactttaaattt
aactacgaccatatcgacgaatcacaaactatcgaagaagattcaaagaaaattcgaaag
attgttagtgactctgtagatgcacatatgattgcagacgttgaagttggtagtttctta
tctagtggaattgattcaagttatgttttagcagaagctgctaaacttaaacctatccaa
tctttctcacttggatttagaaattctaagtatagtgaattaagttactcaactgaattt
gctaaggaaatcaatcaaaagaatacaccactctacatggatggtgatgattactttgat
attttgccaaccatcatgtactacatggatgaaccactatcaaatccatcagcaatgcaa
ttattctatctttccaaaggtactcgtaagaatgtcaaagtggctctttcaggagaaggt
gccgatgaattctttggtggatacaatacttatctagaagctttcacatttgaacgttac
caaaagatggttcctagctttattcgaaaagggttggctaaggcagtttcaggtcttcct
cgtttccatggacgtcgtttcttgatgcgtggggctcagccacttagtgaacgctattac
cgcgtaaattacgtatttaatcaacaagaacgtgatcaaattttacgtaatccagctttg
aatgttgattcaggagcttatacacaacatatctttgacgaagtgaagggcaaagatgag
atgactcaaatgcaatactttgacatcaatacttggcttccatttgatatcttgcacaaa
gctgatcgaatgagtatggctaactcactagaagttcggacaccgttggttgaccgggaa
gtagccaaatttgctgcaaccatgccaattaagactcgaattcataaagaagaaactaag
gtatctcttcgtcgtgctgcagaagctgaattaccagaacgagtagctaagaaggaaaaa
cttggtttcccatctccaatcgccaactggattaaagaagataagtatcgtaaacgaatt
gaagcagctttcaattcagacattgctaagaaattctttaagccagaagctttaatgcat
attcttgatgaacatgttaacggaaaatcaagtatgcaaaagattttcacaatttacaca
tttattttatggtatggagttttcttcccagaagataccaatactaatacaatagattta
gttaagagaactcaagtatag

DBGET integrated database retrieval system